Conserved Protein Domain Family
sulfite_red_B

?
TIGR02911: sulfite_red_B 
sulfite reductase, subunit B
Members of this protein family include the B subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131957
View PSSM: TIGR02911
Aligned: 4 rows
Threshold Bit Score: 487.377
Threshold Setting Gi: 15024461
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK79481       4 NEYVPFLSEIKEVIKHTNIEYTFRMSYDGVVKPGQFFEVSIPKYGEAPISVSGVGENTVDLTIRRVGKVTNEVFERYVGD 83  Clostridium ace...
AAO36948      13 NIYLPFKSTILEIIPHTDIDYTFRMEYKGDVKPGQFFEVSIPKYGEAPISVCGIGENYIDLTIRKVGKVTDVVHTFFPGG 92  Clostridium tet...
P26475        12 HSLLPAAYRILSITRHTPLEWNFRVAVDFPAHWGQFVEVSLPRVGEAPISVSDYGDGWIDLLIRNVGKVTSALFTLKEGD 91  Salmonella ente...
WP_011948642   5 NVYMPFKSEILDIKKHTDIEYTFRMSYEGEVKPGQFFEVSLPKYGESPISVCEIGEGYVDLTIRRVGVVTDEIYNYNIGQ 84  Clostridium bot...
AAK79481      84 KLFLRGPYGNGFDVENYKDKEIVIVAGGTGVSPVRGVVEYFAKNSKEAKSVTLIAGFKTPKDILFSEDFKEWKNNINIIL 163 Clostridium ace...
AAO36948      93 HFFMRGPYGNGFDVDLYKGKELIIAAGGTGLAPVKGVIEHFTKNINNVKSLNVLCGFKSPEDILFKKDIAEWEKTIGFTL 172 Clostridium tet...
P26475        92 NVWLRGCYGNGYPVDTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEIGQLDMILGYKNRDCVLYKEEMATWRGKHNLVL 171 Salmonella ente...
WP_011948642  85 SLFLRGPYGNGFNLDNYKNKEIVVVAGGTGVAPVKGIVDYFSKNPKECKEFNLIVGFKTINNILFKEDIEKWKENINVTV 164 Clostridium bot...
AAK79481     164 TVDSAEGDSNFKEGLVTKYIPELKLQNVKEASAIVVGPPAMMRFSTQGLLDVGFKEENMWISQERKMCCGIGKCGHCKID 243 Clostridium ace...
AAO36948     173 TVDNADEDYKGNVGLITKYVDKIDIKNIEEVNVIIVGPPIMMKFTVQEFLKRGIKQENIWVSYERKMCCGVGKCGHCKID 252 Clostridium tet...
P26475       172 TLDEGEADDRYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKMLLQKGLKPEQIWVDYERRMACSVGKCGHCRMG 251 Salmonella ente...
WP_011948642 165 TLDVAEEGYKGNTGLVTKYIPELNIKDKENVQVVVVGPPIMMKFAVAEFLKLGIKEENIWISQERKMCCGLGKCGHCKID 244 Clostridium bot...
AAK79481     244 DVYVCLDGPVFNFTKGKNLID 264 Clostridium acetobutylicum ATCC 824
AAO36948     253 DTYICLDGPVFNYTKAKQLVD 273 Clostridium tetani E88
P26475       252 EVYVCTDGPIFNYAVAQRFAD 272 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
WP_011948642 245 DTYICLEGPVFNYVKGKTLID 265 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap