Conserved Protein Domain Family
sulfite_red_A

?
TIGR02910: sulfite_red_A 
sulfite reductase, subunit A
Members of this protein family include the A subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131956
View PSSM: TIGR02910
Aligned: 4 rows
Threshold Bit Score: 575.623
Threshold Setting Gi: 16503762
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO36949       1 MGFIMKTKEFNNILDKLAKDYKIYAPKLLRNKGTFSDTDMVRYGEVKTIDEIEFNKKSLFSPKETILPITQTLFYFTEDE 80  Clostridium tet...
AAK79480       1 MGYRLTRENLNTLFHKLKEDYLIYAPKRLIGKGAFSDTDRVRYDKINNVEEIEFDVKSDFSFKEILLPISETLFFFTEDS 80  Clostridium ace...
CAD02751       1 MAIKITPDEFSLLIQRLNKKWRVFAPSAEFRGGRFSDTDNIIYQRISGWRDLIWHEKSHMSPNTIIAPITETLFYFDKNT 80  Salmonella ente...
WP_011948641   1 MGFKIRKENFNSALKNLRKDFKVYGPTTLEGKGTFSDTDSIRYKEISSVEEINFKEKSNFSFKEVILPITQTLFYFTEDN 80  Clostridium bot...
AAO36949      81 VLEPKTDEKNILIFLRSCDIHAVKRLDEIYLKNG-HEDIYYKRLREKVKFVLIECEKSFENCFCTSMGTNKTEDYSLFVK 159 Clostridium tet...
AAK79480      81 VKEAEGPKKGAIIFLRSCDINAVKRLDQIYLKNG-FEDHYYKRIREKVKFVLMPCKTSFENCFCVSMGTNQADMYDASVE 159 Clostridium ace...
CAD02751      81 IQIAETDTSPIIIFARACDINAMSRLDYMYLSNGnNSDYSYQLLREHIRFVLIECEESFENCFCVSMGTNKTDCYSAAMR 160 Salmonella ente...
WP_011948641  81 WIEPKTDKENILIFLRSCDLHGLKRIDNIYLKNG-SEDPYYKAIRERVKFVVMGCSESFENCFCVSMGTNKSENYNLGIN 159 Clostridium bot...
AAO36949     160 RQEDKVLVNCKDEDFLSIFKDFE--EE-KVEPKFIEENELEVKIPK-------KLDN-SIFESDFWKEYSSRCIACGRCN 228 Clostridium tet...
AAK79480     160 LREEHFYIDNKEEKWKEFLKEVSl-EElEVKPSFVMENKTKVKVPE-------GITT-KIFKSKMWDEYDSRCINCGRCN 230 Clostridium ace...
CAD02751     161 FSDEGALVSIRDPFIEAAIQGLG--QEaDYTPSFVSENRETVVTPDsvcrdpqKIRD-ILTRHPLWDAYDSRCISCGRCT 237 Salmonella ente...
WP_011948641 160 IDEENVYVDIKDNSLEKYFNEVQieEKlEIEPRSVKENKVKVNISD-------KINLaKIVNLDFWNEYSKRCIACGRCN 232 Clostridium bot...
AAO36949     229 TVCGTCACFTMQDVFYKDNKNAGERRRVWASCQVDGFTTMAGGHEFRKNKGDRMRFKVMHKIYDFNKRFGY-HMCVGCGR 307 Clostridium tet...
AAK79480     231 FVCPTCTCFSMQDIFYTDNGKAGERRRVWASCMVDGFTNVAGGGSYRSKNGQRMRFKVMHKVYDYKKRNGY-HMCVGCGR 309 Clostridium ace...
CAD02751     238 TGCPTCTCYSVFDVAYDENPQRGERRRQWASCMVPGFSDMAGGHGFREKPGERLRYRALHKVNDYKARNGIeHMCVGCGR 317 Salmonella ente...
WP_011948641 233 FVCPTCTCFNMQDIFYKDNAKSGERRRVWASCQIDGYTNMAGGHGFRIDKGQRMRFKVMHKVNDYKKRFGY-HMCVGCGR 311 Clostridium bot...
AAO36949     308 CDDACQEYISFSNCVNKLNAEIGEEN 333 Clostridium tetani E88
AAK79480     310 CDDICPEYISFSNCINKLKGAIKEVE 335 Clostridium acetobutylicum ATCC 824
CAD02751     318 CDDRCPQYIKFSLIINKMTAAVRQAL 343 Salmonella enterica subsp. enterica serovar Typhi str. CT18
WP_011948641 312 CDDICPEYISFSNCINKLSNLVEEVN 337 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap