Conserved Protein Domain Family

TIGR02909: spore_YkwD 
uncharacterized protein, YkwD family
Members of this protein family represent a subset of those belonging to pfam00188 (SCP-like extracellular protein). Based on currently cuttoffs for this model, all member proteins are found in Bacteria capable of endospore formation. Members include a named but uncharacterized protein, YkwD of Bacillus subtilis. Only the C-terminal region is well-conserved and is included in the seed alignment for this model. Three members of this family have an N-terminal domain homologous to the spore coat assembly protein SafA.
PSSM-Id: 131955
Aligned: 8 rows
Threshold Bit Score: 224.235
Threshold Setting Gi: 20516690
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
tigr:CHY_2600 135 NSTVDRAFNALMNSPTHRANILDPRYTHIGVASVPGGRY-GKLWVQHFCG 183 Carboxydothermus hydrogenoformans Z-2901
AAM24880      163 NSNVIKAHYSLMNSEGHRANILNPYYNKIGVGIVKNKQGnGIIVVELFIK 212 Caldanaerobacter subterraneus subsp. tengcon...
CAB13270      211 QKTPEEVVKAWMNSEGHRKNILNPNFTHIGVGYVESGSI----WTQQFIG 256 Bacillus subtilis subsp. subtilis str. 168
BAD41477      365 HRTPEQVHEAWMNSPGHRSNILNPDFDTIGVGYYEYG------WTQMFIQ 408 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap