Conserved Protein Domain Family
spore_YkwD

?
TIGR02909: spore_YkwD 
uncharacterized protein, YkwD family
Members of this protein family represent a subset of those belonging to pfam00188 (SCP-like extracellular protein). Based on currently cuttoffs for this model, all member proteins are found in Bacteria capable of endospore formation. Members include a named but uncharacterized protein, YkwD of Bacillus subtilis. Only the C-terminal region is well-conserved and is included in the seed alignment for this model. Three members of this family have an N-terminal domain homologous to the spore coat assembly protein SafA.
Statistics
?
PSSM-Id: 131955
View PSSM: TIGR02909
Aligned: 8 rows
Threshold Bit Score: 224.235
Threshold Setting Gi: 20516690
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB05522       80 HLNFEEEVVRLVNQERAKHGLNPLKSNWELARVARIKSEDMRDRNYFSHTSPTYGSPHQMIRNFGI-SYR-SSGENIAaG 157 Bacillus halod...
tigr:CHY_2600  56 LTADEKRFLELTNQARIKNGLKPLAVDPRLVQTARLKAEDMAKLGYFGHISPTYGKPSTMMIAYGIkDYRwIGGENLA-Q 134 Carboxydotherm...
BAB06597      132 LTQDEQRMIDLVNEERQKNGLQPLKANLEITKVARVKAQDMIDNNYFDHNSPTYGSPFDMMRQFGI-EFR-TAGENLA-G 208 Bacillus halod...
AAM24880       86 LSQEEKTLVELVNKERKKNNLLPLQVDENLCKVARLKAEDMRDNDYFSHISPNYGSPFDMLKKFGI-NYY-MAGENIA-V 162 Caldanaerobact...
CAB13270      133 VSAYEKKVVELTNAERQKQGLKPLQIDETLSKSARAKSQDMKDKNYFDHQSPTYGSPFDMMKSFGI-SYK-TAGENIAkG 210 Bacillus subti...
BAD41477      287 IHEFERRVAELVNAERLAAGLQPLRLDPGLSRVARLKSRDFVTGGYFGHESPTYGSPFEMMKQFGF-TYR-MAGENIAlG 364 Symbiobacteriu...
AAK80187       48 LAAEESQVIKLVNSQRAKYGLAPLKANTQLINIARVKSRDMMMKNYFSHTSPTFGSTFSLLTRYGL-SYA-AAGENIAyG 125 Clostridium ac...
WP_021133833  127 VAALENEVVTLVNAERAKAGLPALKANAELSNVARLKSQDMIDKKYFSHTSPTYGSPFDMMKKFGV-KYS-AAGENIAsG 204 Clostridium bo...
BAB05522      158 QSTPQAVFQAWMNSSGHRQNILSSNYTEIGVGYARGGSY-GHYWTQMFIG 206 Bacillus halodurans C-125
tigr:CHY_2600 135 NSTVDRAFNALMNSPTHRANILDPRYTHIGVASVPGGRY-GKLWVQHFCG 183 Carboxydothermus hydrogenoformans Z-2901
BAB06597      209 NQTVEAAHQALMNSQGHRANILSPNYTEIGVGVVEGGPY-GKMFVQMFKG 257 Bacillus halodurans C-125
AAM24880      163 NSNVIKAHYSLMNSEGHRANILNPYYNKIGVGIVKNKQGnGIIVVELFIK 212 Caldanaerobacter subterraneus subsp. tengcon...
CAB13270      211 QKTPEEVVKAWMNSEGHRKNILNPNFTHIGVGYVESGSI----WTQQFIG 256 Bacillus subtilis subsp. subtilis str. 168
BAD41477      365 HRTPEQVHEAWMNSPGHRSNILNPDFDTIGVGYYEYG------WTQMFIQ 408 Symbiobacterium thermophilum IAM 14863
AAK80187      126 YNNAASVMNGWMNSPGHRANILGRQYREIGVGAARSRSG-KIYWTQVFIK 174 Clostridium acetobutylicum ATCC 824
WP_021133833  205 YPTAKAVVDGWMNSPGHKANILSKSFTEIGVGLAKSSDG-TYYWTQMFIN 253 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap