Conserved Protein Domain Family
CoxD_Bacillus

?
TIGR02908: CoxD_Bacillus 
cytochrome c oxidase, subunit IVB
This model represents a small clade of cytochrome oxidase subunit IV's found in the Bacilli. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131954
View PSSM: TIGR02908
Aligned: 3 rows
Threshold Bit Score: 138.464
Threshold Setting Gi: 22777122
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P24013     1 MVDKKSRGHINSDLEFKKKKHAREMKYQVLSFGLMIGLTIVAFLTVATDGVGSWFTIPFIILLAAIQVIFQLYYFMHMNQ 80  Bacillus subtilis s...
BAD75370   1 MANQTNSGNERIDLAYRRRKNAEEMRHQMIAFVLMILLTLIAFAAVGYEEFSHWFVVPFILLLAAVQVAFQLYYFMHMSH 80  Geobacillus kaustop...
BAC13396   1 MTDNMSTRKINS---FQKAKNKEEMKKQIVTFALMIFFTLIAFFAVML-EIDKMFVIPLLLILAVVQIAFQFFYFMHMKD 76  Oceanobacillus ihey...
P24013    81 KGHEAPALFLYSGVFVAFITVLAFVTIIWW 110 Bacillus subtilis subsp. subtilis str. 168
BAD75370  81 KGHEFPAMFIYGGVAVMLLLVWAFTTVVWW 110 Geobacillus kaustophilus HTA426
BAC13396  77 KGHEVPSQIIYGGIFVTMLVILTFTVITWW 106 Oceanobacillus iheyensis HTE831
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap