Conserved Protein Domain Family

TIGR02908: CoxD_Bacillus 
cytochrome c oxidase, subunit IVB
This model represents a small clade of cytochrome oxidase subunit IV's found in the Bacilli. [Energy metabolism, Electron transport]
PSSM-Id: 131954
Aligned: 3 rows
Threshold Bit Score: 138.464
Threshold Setting Gi: 22777122
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P24013    81 KGHEAPALFLYSGVFVAFITVLAFVTIIWW 110 Bacillus subtilis subsp. subtilis str. 168
BAD75370  81 KGHEFPAMFIYGGVAVMLLLVWAFTTVVWW 110 Geobacillus kaustophilus HTA426
BAC13396  77 KGHEVPSQIIYGGIFVTMLVILTFTVITWW 106 Oceanobacillus iheyensis HTE831
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap