2Q83


Conserved Protein Domain Family
spore_CotS

?
TIGR02906: spore_CotS 
Click on image for an interactive view with Cn3D
spore coat protein, CotS family
Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131952
View PSSM: TIGR02906
Aligned: 16 rows
Threshold Bit Score: 318.071
Threshold Setting Gi: 28203434
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Q83_A       37 IDVIQGNQXAL--VWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGx-NVPGILPNKKGSLYSKHGSFLFVVYDWI 113 Bacillus subtilis
CAB15070     48 IDVIQGNQMAL--VWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGm-NVPGILPNKKGSLYSKHGSFLFVVYDWI 124 Bacillus subtili...
ZP_00504161  30 ISVVQSANIKT--VWRIKTKDRELCLKRLKHPLDKALFSVNAQDFIYNHGg-NVAGIIRDKEGNLIHSFNDQLFVVYEWL 106 Clostridium ther...
BAD75122     42 MQIVTTKPDKGgaIWKLETKSGPKSLKLLHRRPTRSLFSLGAQEYLVEVRkaRVPPIVKTKDEKSYVEAGGKLWFVAEWI 121 Geobacillus kaus...
AAO36517     36 IKFKNTDKQRA--VYKVSHGSKNYCLKKVYFPEEELLFVYSAIEWMHRYNi-KVPRILPTLESNRFVNYENMLFILTPWI 112 Clostridium teta...
AAK80852     16 INAEASQKIKN--VYRVNSSSKNYCLKCIHYDYGHVLFIVKAMEHLKENGfdKIPEIIPTSSGEKFIKFRSCYVYLTEWL 93  Clostridium acet...
BAB81928     16 IEVKEVIKVKN--TYKIITSDEEYCLKVIKYQYPHFYFIVSAQKHLMKNGfnSIPKILDTIDGKDYVRLDDKLAYLTPWV 93  Clostridium perf...
BAB81926     27 LDIFDLRPNRN--VFLLDTKQGKKILKMINYDDDRLNFIIHSTEYLRERYd-GILKINKLPNGEWRFKWKGNYYILLDYF 103 Clostridium perf...
ZP_00911378  27 IKVNDIVPLRK--VFLVYTDEGNKILKRVNYDVDRVNLISDSLDYVKKSYe-HVITYKRFKDDLCYKEWNGQIYIVMDIL 103 Clostridium beij...
AAO35876     37 LQVLSIERVRS--VYKVETNCGNICLKEIAKNKRKPVNGSILVEELDKHGfpYIAKYFKTTDDHLFVKYNKSYYYVTEWI 114 Clostridium teta...
2Q83_A      114 EGRPFE--LTVKQDLEFIXKGLADFHTASVGY-QPPNGVPIFTK--LGRWPNHYTKRCKQXETWKLXA-EAEKEDPFSQL 187 Bacillus subtilis
CAB15070    125 EGRPFE--LTVKQDLEFIMKGLADFHTASVGY-QPPNGVPIFTK--LGRWPNHYTKRCKQMETWKLMA-EAEKEDPFSQL 198 Bacillus subtili...
ZP_00504161 107 YGRDLS--FVNADDLKSALHGLAKFHIASKGY-VAPEGAKVSSK--LGRWPEQYKSMADKLSSWKEAS-LGKPASASVNA 180 Clostridium ther...
BAD75122    122 EP--LTpvTKDLEGARKLCYALGEFHRLSKGY-VPPKQAEMASR--LHKWPKNYEKMITKMSWFRNIA-KYYPEMPASPP 195 Geobacillus kaus...
AAO36517    113 EGCKCD--YDNPIHVTRSTENLSLMHHHSSKF-FPILGSDNREK--FDNVYDTTEKRFNQLLECSNLA--FKYKDKFSKY 185 Clostridium teta...
AAK80852     94 DARVCN--FDNPIDLYTAVKALSSLHLKSRSF-EVTDNMNPRVG--WFNWRENFKRRKDEILKFKKIIcDKEKKTEFDNL 168 Clostridium acet...
BAB81928     94 KCRECD--YKNKWDLSLAAKKLSELHNSSEGF-VINRDLKPRIA--WGKWYKIFETRGEEILDFKKRIyQKAYMSDFDKL 168 Clostridium perf...
BAB81926    104 EGTEFN--IANPIELEIITDAVAKLHNAGMGIqEATSKEMNEKNseLFKLKDYFKNSKKDLEKLKEIVgSYKYKNEFDEI 181 Clostridium perf...
ZP_00911378 104 NGREAS--FSNPVEIDLCAENIALMHKASKGLrEYLKDKYKKDFldIS-LKDKIKEAYDDLIWMKSLVdTYKYKNEFDKL 180 Clostridium beij...
AAO35876    115 NGHECN--LNDINEARKCMKLMANFHITTFKI----DGSKLKLRnnLKNWPKIFFSKLKDIQYFKHIIkNKRVVTEFDNL 188 Clostridium teta...
2Q83_A      188 YLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGE-NEqIWVIDLDTVSFDLPIRDLRKXIIPL 266 Bacillus subtilis
CAB15070    199 YLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGEnEQ-IWVIDLDTVSFDLPIRDLRKMIIPL 277 Bacillus subtili...
ZP_00504161 181 YLKNVDEMLDICHRAMELLNASKYAELAGENSKSAVLCHQDYGKGNALFTD-NG-VYVIDLDGVTWDHPGRDLRKIIGKL 258 Clostridium ther...
BAD75122    196 LLEVVDRFEEQARKGMERFLQSSYVEFVKQGTAHWGLVHQDYGWSNGQMGA-DG-MWIIDLDGVAFDLPIRDLRKLISGT 273 Geobacillus kaus...
AAO36517    186 FLSHFDANLNTAKNILALSCTINHNNLQKNL------CHLDYVNKNIILDNnNN-VWVIDFDKCRIDYRVHDIGYFMRRY 258 Clostridium teta...
AAK80852    169 YMKLMEEELSKADKSIQDIENSEYVNKMNEEFRLKGFCHHDYAHHNILIDKeGK-AHIIDFDYCMLDTHLHDLSSILIRK 247 Clostridium acet...
BAB81928    169 YLSIMDEELKRVERTLSHIKTSGYFDYMKKEVKKLGFCHHDYANHNVLLLEnNE-INIIDFDYCILDSHLHDLSSLCIRT 247 Clostridium perf...
BAB81926    182 FIKEVDYHLSDVEKCIDLLEKSKYDDLCRDKEKITL-CHNDLAYHNILFNQ-NK-VSFIDFDYCNINLRVIDLCNFIIKS 258 Clostridium perf...
ZP_00911378 181 FVNNVDKYLNEIKEVQNDLEKSSYDNLRQDGDTIRL-CHNDLAYHNFLTKN-NE-INIIDFDFMTIDLRVMDIWNFILKC 257 Clostridium beij...
AAO35876    189 YNSVIDDFYNMGITALHLLNSSDYYSLSRKANSKRSICHDSIYYQNIIKKD-DD-YYLIDLDSIKIDIHINDLGKVIRRL 266 Clostridium teta...
2Q83_A      267 L-DTTGVWDDETFNVXLNAYESRAPLTEEQKQVXFIDXLFPYELYDVIREKYVRKSALPKE----ELESAFEYERIKANA 341 Bacillus subtilis
CAB15070    278 L-DTTGVWDDETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKE----ELESAFEYERIKANA 352 Bacillus subtili...
ZP_00504161 259 S-ENRGAWSLDQIEKILDWYSEINPLSTADRELIYIDLMYPHWFFGLVKNIFKNNKSESPS----KIEKTARLETSKVPL 333 Clostridium ther...
BAD75122    274 M-ADLYKWDATWVREMILAYHEANPITPELYELLMIDLAMPNEFYKNMKEVVYEPEIFLNEqtaqLIQTIVETDQSKWPV 352 Geobacillus kaus...
AAO36517    259 LrRDNTSWDVKKAIECIEIYEGINPLNLDEHKYILCYIGFPQKFWKISRDYYRNIKRCNKNsffkVLTSSIEKEKEQDDF 338 Clostridium teta...
AAK80852    248 M--KNGLWDMKCCLFILNTYNEDYKIENNDIPIMASFMEFPQGYWQVGLQYYVEKQPWTEEffmsRLNKIYKDKDERQEF 325 Clostridium acet...
BAB81928    248 M--KEGRWDLNLFKYIIESYSKNKEVRNEEFPIIASFIEFPQAYWQLGLQYYWEQQPWEEEhflkKLGKYEKDREFRQNF 325 Clostridium perf...
BAB81926    259 I--KRFGFSLEMYDSIIEKYDKLNNLSKEEKELMYIYLRFPHDFYTVSMQYYYKLKDWKYEsflnKLERKLEYTKEKEIL 336 Clostridium perf...
ZP_00911378 258 I--KNAAFDVDKMSTCINGYENVSILKKEEKELLYILIKFPKDFYTISRDYYHKRKNWEYEvylsRFEGKLSNEDFRYEF 335 Clostridium beij...
AAO35876    267 MfKKEYQWDFNKAKELIEAYSSANPLDKADLGAMLSIIVFPHKFWKLGKNRYVKEKHWSEEkyikKLNKLIDFDVLQQKF 346 Clostridium teta...
2Q83_A      342 LRQL 345 Bacillus subtilis
CAB15070    353 LRQL 356 Bacillus subtilis subsp. subtilis str. 168
ZP_00504161 334 LAEK 337 Clostridium thermocellum ATCC 27405
BAD75122    353 LAEI 356 Geobacillus kaustophilus HTA426
AAO36517    339 VIDF 342 Clostridium tetani E88
AAK80852    326 LEDF 329 Clostridium acetobutylicum ATCC 824
BAB81928    326 VDEL 329 Clostridium perfringens str. 13
BAB81926    337 LNHI 340 Clostridium perfringens str. 13
ZP_00911378 336 LKVL 339 Clostridium beijerinckii NCIMB 8052
AAO35876    347 IKDY 350 Clostridium tetani E88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap