Conserved Protein Domain Family
spore_yutH

?
TIGR02905: spore_yutH 
spore coat protein YutH
Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131951
View PSSM: TIGR02905
Aligned: 5 rows
Threshold Bit Score: 481.183
Threshold Setting Gi: 145903143
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB07142        3 ERNVYDSFQLYCDSRFRTGRFQGFYAQGQPYLLVPREQIEPDEEAAILEMGEYLQRAGDGTVLKLIKAKTGPLHAKIDGQ 82  Bacillus halod...
novoz:BL02139   4 KELIKEKFGIYIRDLTSYLSYQAFHTPNSMFLIVPVSHLSQDELAELFSMSQYLQEQRDPYVSSFILTKDGEMTFEENGV 83  Bacillus liche...
ZP_01173413     3 RQMLKQHFGIQAEEELRIGLHEAFKKDNQLYIPMEV-GLEEEDLAELSLIASHLQQTGDKTVSTFLQTTEGKHSSVWEQK 81  Bacillus sp. N...
BAD77251        2 EEWVREQYGMRVERLERSGRHAAFWHRQERFLLVPADGQSEAEMEERQRMSRYLRAKGVDGVGELVKTTSGTYIASYNGQ 81  Geobacillus ka...
BAD65477        3 ERNLYDQYKLYCDERFTVGPYEGFRANNQAYIILPKDECMAEEV-EMMAFCDFMRQAGDESVLELVPNRFNQSSALIDGV 81  Bacillus claus...
BAB07142       83 DVYLFQIPYEYERFGMlqt-deDIGRHLATFHQAGAQYVGTAYQKGAYGKWPRLWEKRLEQLEEWHQRLLAQGPRTLVDE 161 Bacillus halod...
novoz:BL02139  84 SYVLLQAAPRMTNRSV------SFGAELAEFHHKGRGYPYEVKETSRIGQWKELWGKRLDQLEQFWIQKTQARQLQPFEK 157 Bacillus liche...
ZP_01173413    82 SYCVLKCPNAQPRKGY------QSGRKLAKFHYRGRLISSPITRTSRIGQWKQLWEKRLDQMEKVWNSMLFQQPEHELDR 155 Bacillus sp. N...
BAD77251       82 PLALVRAPLPAARFR-------SLGRELAVMHECGRTCPWPIVACRRIGQWRELWAKRIDQMEAFWSSKLASGPSSLFDR 154 Geobacillus ka...
BAD65477       82 EAYVFKVPEFNEFRGVriqsewDLGEQLFTWHKRGQQ-GRQHWKKASFPPWQELWATRLEQLEDWYQALVNQGPQTTTDE 160 Bacillus claus...
BAB07142      162 QFLFTFPYYLGMTENAIQFAVDAHYDEGGIERERGTICHKRFHNDTWi--rLENGRLKVPTEFVYDHPSRDLAEWLRS-K 238 Bacillus halod...
novoz:BL02139 158 QFIESFPYYLGLTENAIQYLADTELDDQPQAADSGTICQQRLTCEAL----RREPLIKIPMEWVFDHAARDLAEYARS-L 232 Bacillus liche...
ZP_01173413   156 MFLETFPYYMGLAENSIQYLADAELDDEPGPADSGTVCHERFVSSTWg---SDDYLIKSPFDWVFDHASRDLAEWSRE-R 231 Bacillus sp. N...
BAD77251      155 LFIESFPYYLGLAENAVQYVADTEIDEEPGRIDYAAFCHERLPEAKW----VGGGEAKLPTDWVYDHCARDLAEWVRH-L 229 Geobacillus ka...
BAD65477      161 AFLCTYPYFMGMTENAIQFAVDTQLDVKKELHDEPTICHRRFGETSWlymsERGHIVKPPTAFLYDHPARDLAEWIREnR 240 Bacillus claus...
BAB07142      239 EleIARPEDRalAIQSFLHAYGQHAPLTRLCRRFIFARLLFPVHYFQTIEDYYSCQiEEKRRTLEKEVLHLFEKETTHEQ 318 Bacillus halod...
novoz:BL02139 233 F--HERKNFN--EIMLFLQQYEQAAPLSSFSKRLMYSRLLFPLHYFETLEGYYISP-ESEHHYFESRLDYLLSQAPAYEQ 307 Bacillus liche...
ZP_01173413   232 YfrNIKTYQP--GLSQYLKEYQTVEPLTSFSWRLLYARLLFPLHYFECIENYYGNPtEHQRHLSEEQLGRFLQHTGDHEE 309 Bacillus sp. N...
BAD77251      230 YekSGLGCQR--AVRQFFQEYEHAAPLSPFAWRLVYARLLFPLSYFECVEAYYIAVdESERTRREGELRRLLDRSHEYER 307 Geobacillus ka...
BAD65477      241 PmgEIRQNWE--RIASFFGGYEEWQVLTPYTWQMMYARLIFPLHYFEVIENYYQAQlPHEQREYGKQFQQLLDRETSNAD 318 Bacillus claus...
BAB07142      319 FLRMV 323 Bacillus halodurans C-125
novoz:BL02139 308 FLNGF 312 Bacillus licheniformis DSM 13 = ATCC 14580
ZP_01173413   310 FLGKF 314 Bacillus sp. NRRL B-14911
BAD77251      308 FLAAF 312 Geobacillus kaustophilus HTA426
BAD65477      319 FLGEL 323 Bacillus clausii KSM-K16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap