Conserved Protein Domain Family
spore_lonB

?
TIGR02902: spore_lonB 
ATP-dependent protease LonB
Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis. [Protein fate, Degradation of proteins, peptides, and glycopeptides, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131948
View PSSM: TIGR02902
Aligned: 5 rows
Threshold Bit Score: 945.362
Threshold Setting Gi: 77997058
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD39345        5 GIFAIIHVLFAVVIGVYFWNLLRSQQGNRLAVERESRRELDKLRRMRAVRLTEPLSERTRPASFDEIVGQEEGIRALRAA 84  Symbiobacteriu...
tigr:CHY_0329   6 GILAVGQIILLAAILALLFSQGKAQQVNKSYLERESEKELAKLNHLRRISLTEPLAEKTRPENFSEIIGQEEGIEALKAA 85  Carboxydotherm...
P42425          5 GIALFIQLFFGIIIGLYFWNLLKNQRTQKVTIDKESKKEMEQLRKMRAISLSEPLSEKVRPKSFKDIVGQEDGIKALKAA 84  Bacillus subti...
AAK80585        3 NVIIIVEMIFNIIIGIYFFYALKNQQFGRISIDKENKKELEKLNDMRKIRLSIPLCEESRPKSFDEIIGQKNGIKTLKAS 82  Clostridium ac...
AAO36846        3 EVFMFVQFIITIIMGLYFFNALKGQKTNKITIDKESKKEIDTLNKLRSIKLTQPLTEKSRPNSFAEIIGQDKGIMALKAA 82  Clostridium te...
BAD39345       85 LCGPNPQHVIIYGPPGVGKTAAARLVLEEAKRNPASPFGPDAAFVEIDATTARFDERGIADPLIGSVHDPIYQGAGPLGL 164 Symbiobacteriu...
tigr:CHY_0329  86 LCGPNPQHVILYGPPGVGKTAAARLVLKEAIKSPASPFKEGAAFVEVDATCTRFDERGIADPLLGSVHDPIYQGAGPLGI 165 Carboxydotherm...
P42425         85 LCGPNPQHVIVYGPPGVGKTAAARLVLEEAKKHKQSPFKEQAVFVELDATTARFDERGIADPLIGSVHDPIYQGAGAMGQ 164 Bacillus subti...
AAK80585       83 ICGPNPQHVIIYGPPGVGKTAAARLALEYAKTCAFSPFNDKAKFVEIDATTLRFDERGIADPLIGSVHDPIYQGAGKFGN 162 Clostridium ac...
AAO36846       83 LCGPNPQHVIIYGPPGIGKTAAARLVLEYAKKNTSSPFKEEAKFIEIDATTIRFDDRGIADPLIGSVHDPIYQGAGPLGV 162 Clostridium te...
BAD39345      165 AGIPQPKPGAVTRAHGGILFLDEIGELHPVQMNKLLKVLEDRKVFLESAYFSPDDPNIPSHIKDIFQNGLPADFRLVGAT 244 Symbiobacteriu...
tigr:CHY_0329 166 AGIPQPKPGAVTKAHGGILFIDEIGELHPVQMNKLLKVLEDRKVFLESAYYFSENPEIPQHIHEIFQKGLPADFRLIGAT 245 Carboxydotherm...
P42425        165 AGIPQPKQGAVTHAHGGVLFIDEIGELHPIQMNKMLKVLEDRKVFLDSAYYSEENTQIPNHIHDIFQNGLPADFRLIGAT 244 Bacillus subti...
AAK80585      163 AGIPQPKMGAVSRAHGGVLFIDEIGELNPIEMNKLLKVMEDRKVFFDSAYYNSSSENMPEYIREVFEEGFPADFRLIGAT 242 Clostridium ac...
AAO36846      163 AGIPQPKAGAVTKAHGGVLFIDEIGELHPTIMNKLLKVLEDRKVFLDSAYYNSSDPNVPSYIRDIFDNGFPADFRLVGAT 242 Clostridium te...
BAD39345      245 TRLPHEIPAALRSRCMEIFFRPLLPEEVAQVARRAAEKVGLVLEPDAEEVIKRYAASGREAVNIVQLAAGVLAGTGRRSI 324 Symbiobacteriu...
tigr:CHY_0329 246 TRKPEELPPALRSRCVEIFFKPLGDEEIREIAQNAAKKIGISLGKHALQTIVKYANSGREAVNIVQLAAGLALGEGRKRI 325 Carboxydotherm...
P42425        245 TRMPNEIPPAIRSRCLEVFFRELEKDELKTVAKTAADKIEKNISEEGLDLLTSYTRNGREAVNMIQIAAGMAVTENRKDI 324 Bacillus subti...
AAK80585      243 TKNPEEINPAIRSRCIEIFFRALDAEEIKIIAKNAVEKINVNIDSKALELIAMYSSNGRDVINLIQLACGIVINENRGRI 322 Clostridium ac...
AAO36846      243 TRNPEEITPALRSRCVEIFFRGLLSEEIQEICKKSVEKIGFTLEKSACDMIGLYASNGREAINLLQLASGIALNEDRKKI 322 Clostridium te...
BAD39345      325 PRSEVEWVINSGQLQPRPDRRIPSKPQVGSVNGLAVSGPNVGHLLELEVDVRRARAAGqGVVIVTGVVDEEEMGGPGRTM 404 Symbiobacteriu...
tigr:CHY_0329 326 LARDVLFVARAGNYHPKPQIVLSDEPAIGRALGLAVTGPKSGAVLAVEALAEPAENLP-GSINVSGIIEEEKFSQSHTEL 404 Carboxydotherm...
P42425        325 TIEDIEWVIHSSQLTPKHEQKIGVEPQVGIVNGLAVYGPNSGSLLEIEVSVTAAQDK--GSINITGIAEEESIGSQSKSI 402 Bacillus subti...
AAK80585      323 EAEDILWIAENGRYSLRSYKKLSSVSRIGCVNGLGVFGIDNGIVMDVEATAVRVENSV-GQIKITGIIEEEEISGYNKKV 401 Clostridium ac...
AAO36846      323 IKSDIEWVVENGNYHPKVEIKVAKEPKIGLVNGLGVYGSNIGAVMPIEITAIKNSLGR-GKVNVAGIIEQEQMGGNGRSV 401 Clostridium te...
BAD39345      405 RRKSMAKGSVENVLTVLKQYLDEDPRDYDIHVNFPGGVPVDGPSAGVAIAVAVYSAFTGRPVDNRTAMTGEVSIRGLVKP 484 Symbiobacteriu...
tigr:CHY_0329 405 IARSKIRGALDNVFAVFRSQTGINPQKYDIYFNFPAPWPVDGPSAGLALLVALYSAVFRCLIPAKTAFTGEISLLGEICP 484 Carboxydotherm...
P42425        403 RRKSMAKGSVENVLTVLRTM-GMKPSDYDIHINFPGGIPIDGPSAGIAMAAGIFSAIHKIPIDNTVAMTGEISLNGLVKP 481 Bacillus subti...
AAK80585      402 KKKSSIMASAENAISMIENVFNINIKNYDIHIDFQGGYAVDGPSAGVSIACAIFSALKKLPIKSKVAMTGEITLNGIVKP 481 Clostridium ac...
AAO36846      402 QRKSSARCSVENVCAVLKSVFNIQLENYDVHINFLGGIPIDGPSAGISIAIGIYSAINLVPIDNMVAMTGEISLYGDVKA 481 Clostridium te...
BAD39345      485 VGGVVAKVEAARQAGCTRVIIPQENWQECFARlSGIRVVPVERLDEVFAVAF 536 Symbiobacterium thermophilum IAM 14863
tigr:CHY_0329 485 VGGIPDKIEAAVRAGVKTVFLPWGNYPEVEGN-KKINLVPVKSVDEALNYLF 535 Carboxydothermus hydrogenoformans Z-2901
P42425        482 IGGVIPKIKAAKQSGAKKVIIPYENQQAILKQiDGIEIIAVKTFQEVLDEIL 533 Bacillus subtilis subsp. subtilis str. 168
AAK80585      482 VGGVSSKVTAAAKAGAELVIIPYDNWNKSFDSySNIKVIGVKNIKEILSYVL 533 Clostridium acetobutylicum ATCC 824
AAO36846      482 VGGVNSKIEAAKKAGAKKVLIPKENWQESYESiESIQVIPINNIMEAIEVAL 533 Clostridium tetani E88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap