Conserved Protein Domain Family
spore_YhcN_YlaJ

?
TIGR02898: spore_YhcN_YlaJ 
sporulation lipoprotein, YhcN/YlaJ family
YhcN and YlaJ are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic 40-residue C-terminal domain that is not included in the seed alignment for this model. A portion of the low-complexity region between the lipoprotein signal sequence and the main conserved region of the protein family was also excised from the seed alignment. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131944
View PSSM: TIGR02898
Aligned: 8 rows
Threshold Bit Score: 155.603
Threshold Setting Gi: 500497796
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CHY_1593    4 GLHILLLLALFFaaVACTPARK--------PAPTVP------------------------------PGGSPTTLPTN--Q 43  Carboxydother...
O07634           3 ILFIIIQLTLIL--SACAYQQGkqgqnvekESTRQQet--------------------------kpIHVKDTTQETK--D 52  Bacillus subt...
tigr:GBAA_2746   3 ILIYILMVCFLI--TGCSIGKKd------sPNEKSEqknv----------------------smknVNYTNKSNKPN--E 50  Bacillus anth...
BAD63500         6 QFSAICLIGLVL--TGCGMAQNnndrdqqvDDNDNRete------------------------trqQGYDDNAGPVE--D 57  Bacillus clau...
WP_011099745    20 NLLLSVFILTAL--GGCTPNNTaknrnvtpPPNTAGernndttn---------------tdmaknnITGDNVAKDNM--A 80  Clostridium t...
WP_011065506     4 RIFAIMALLFVL--VACQNAEEns-----mDNNNMGegnveptrydn--------nsnlgqemsdkNNSMQRDADQN--Q 66  Oceanobacillu...
CAA65698         7 VLASVLLIPLLM--TGCGVADQgeg---rrDNNDVRnvny----------------------rnpaNDDMRNVNNRD--N 57  Bacillus subt...
WP_011948161     9 lfttgllslslllgtgCTNKSAkn-----pPANNAtknvtekanentanknaangnatnenakdgtSTGENINGNTTvtD 83  Clostridium b...
tigr:CHY_1593   44 -TE--------------------LNKIAKKIAREAA-KTEKVKKATAVITGSTAYVGLDLVAGVE---------KSETDK 92  Carboxydother...
O07634          53 nGT--------------------RTDIAKHLVSVAE-KNPDVKDATAVVLGGYAVVGIDVDDTLD---------RSKVET 102 Bacillus subt...
tigr:GBAA_2746  51 -------------------------KAADHLASLAA-SVPGVNDATAVVVGKYAIVGIDVKAKLD---------RTRVES 95  Bacillus anth...
BAD63500        58 -----------------------RLEVADETAERVA-ELDEVERANVLIAGDNAYVAVMMTNRGE---------DEVTEE 104 Bacillus clau...
WP_011099745    81 -GD--------------------LYQRSTKIANEVA-KIKGIKSANVVISDDRALIGVDMENNAE---------GKITDA 129 Clostridium t...
WP_011065506    67 -NT--------------------KYDVSEEAAKKIAeKVEGIEDAYVLTTDNNAYVGAHLNQENNnngnnsqsgDNVSDE 125 Oceanobacillu...
CAA65698        58 -VDnnvndnannnrvnddnnndrKLEVADEAADKVT-DLKEVKHADIIVAGNQAYVAVVLTNGNK---------GAVENN 126 Bacillus subt...
WP_011948161    84 -GD--------------------LSRRSQKIADELV-KIKGIEKARVVISERRALVGVTIPNSVE---------GKMTSD 132 Clostridium b...
tigr:CHY_1593   93 IKEEAANRVKSaEPRLKRVYVTTDADTVTRIRHVAEGLAKGRPLSSLMRELDEIKRRMVP 152 Carboxydothermus hydrogenoformans...
O07634         103 IKYSVAQALKN-DRYGANAVVIADPDTVSRLREMSREISEGHPVTGILDELAAIVGRVLP 161 Bacillus subtilis subsp. subtilis...
tigr:GBAA_2746  96 IKYSVAESLKN-DPDGANAVVVADVDTYERLKQIGKQIKKGKTGEGILDELAAIVGRVMP 154 Bacillus anthracis str. 'Ames Anc...
BAD63500       105 LKEKIAEQVRKtDENMNNVYVSSNPDFVERARDYTDRINNGEPVKGFVDEFNETIRRIFP 164 Bacillus clausii KSM-K16
WP_011099745   130 LKSQVESTTKKtDNRIKTVAVSADPDIFERISNVGTGIQEGKPLSEFGNEIEELFRRIMP 189 Clostridium tetani
WP_011065506   126 MKEQIANIVRSvDNSIENVYVTTNPDFMDLTDRYMNDVDEGRPVEGFFDQIGNMIERVFP 185 Oceanobacillus iheyensis
CAA65698       127 LKKKIAKKVRStDKNIDNVYVSANPDFVERMQGYGKRIQNGDPIAGLFDEFTQTVQRVFP 186 Bacillus subtilis subsp. subtilis...
WP_011948161   133 LKKKVDETVKKtDKEIDTVAVSADADVYDRITKIADGIKGGRGIQEFGTEFKELFNRIIP 192 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap