Conserved Protein Domain Family
QoxC

?
TIGR02897: QoxC 
cytochrome aa3 quinol oxidase, subunit III
This family (QoxC) encodes subunit III of the aa3-type quinone oxidase, one of several bacterial terminal oxidases. This complex couples oxidation of reduced quinones with the reduction of molecular oxygen to water and the pumping of protons to form a proton gradient utilized for ATP production. aa3-type oxidases contain two heme a cofactors as well as copper atoms in the active site. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131943
View PSSM: TIGR02897
Aligned: 3 rows
Threshold Bit Score: 269.803
Threshold Setting Gi: 51978079
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:SACOL1068     9 DSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFELPLVLIMTFALLFSSYTCGIAIYYMRQEK 88  Staphylococ...
CAC95248          13 EYRSEQGRLNILGFWIFLGAEIALFATLFATYFVMRKAGSNAGHPPAEMFELWLVLIMTFLLLASSFTCGLAIGEMRKGN 92  Listeria in...
jgilanl:BCZK0612  11 EYQSEQSRLNILGFWIFLGAEIMLFATLFASYLVLAGR-TADGPTPAQLFELKTLLIQTLLLLTSSFTCGIVIHEMRKHN 89  Bacillus ce...
tigr:SACOL1068    89 QKLMMFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNA 168 Staphylococ...
CAC95248          93 VKMLTIYSIITLILGAGFVGFELYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTPKTA 172 Listeria in...
jgilanl:BCZK0612  90 QKAMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGTHGAHVTGGIIWAICVIIQILKRGLTPVTA 169 Bacillus ce...
tigr:SACOL1068   169 PKLFIVSLYWHFLDVVWVFIFTAVYMIGMV 198 Staphylococcus aureus subsp. aureus COL
CAC95248         173 SKVFISSLYWHFLDVVWIFIFTGVYLLGMV 202 Listeria innocua Clip11262
jgilanl:BCZK0612 170 RKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199 Bacillus cereus E33L
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap