Conserved Protein Domain Family

TIGR02896: spore_III_AF 
stage III sporulation protein AF
This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment. [Cellular processes, Sporulation and germination]
PSSM-Id: 131942
Aligned: 12 rows
Threshold Bit Score: 56.1396
Threshold Setting Gi: 10175413
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
BAD76688       82 QIEQQKKEIQASQRAYILKQMAVQLENDVNEEL 114 Geobacillus kaustophilus HTA426
P49783         79 QINSKKIEIQASQRAYILEEMAVQLKKKAEERF 111 Bacillus subtilis subsp. subtilis str. 168
BAC13845       82 QIEFQKNEIQASQDAYILEQMAVQLENVAEDPL 114 Oceanobacillus iheyensis HTE831
AAT62824       79 SIDSKKKEIQALTRAYSLEEMATKMKKEVGKEF 111 Bacillus thuringiensis serovar konkukian str. 97-27
BAB06511       79 DWNSKKDDIESDMRAYISEQMAVQLKRQVEEEF 111 Bacillus halodurans C-125
AAK80047       76 TYDQELKGSDGEEINSIVDEFKKNLEDKCSKML 108 Clostridium acetobutylicum ATCC 824
BAD40842       77 EIARQAERFQARTQALLLEELQDRIRRAAEEAA 109 Symbiobacterium thermophilum IAM 14863
AAM24512       75 AFEGFSEKAKEQTKILIAKEYKNRLSQQIREKL 107 Caldanaerobacter subterraneus subsp. tengcongensis MB4
tigr:CHY_2002  64 -LPESQSKTVAVSQGSLLENARSEAEKTLEAQV 95  Carboxydothermus hydrogenoformans Z-2901
AAO36131       77 ESKESFFQYKEKNIERTKENFNKNLQEVVDKKL 109 Clostridium tetani E88
WP_025776139   76 DYKNDFDKYKKKNREETLNNFKANLQNQTKKRL 108 Clostridium botulinum
WP_011592694   68 KISDVTKSNEEKKSLYDEEAILKSVEKNLEKSL 100 Clostridium perfringens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap