Conserved Protein Domain Family
spore_sigI

?
TIGR02895: spore_sigI 
RNA polymerase sigma-I factor
Members of this sigma factor protein family are strictly limited to endospore-forming species in the Firmicutes lineage of bacteria, but are not universally present among such species. Sigma-I was shown to be induced by heat shock () in Bacillus subtilis and is suggested by its phylogenetic profile to be connected to the program of sporulation (). [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131941
View PSSM: TIGR02895
Aligned: 6 rows
Threshold Bit Score: 268.169
Threshold Setting Gi: 20515095
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD75217        17 VVEIQRGNEAlRNELIRQYKPFIVKTVSSVCKRFI-REEDDEASIGLIAFNEAIEKYALHKGGSFLSFAELLIKRRLIDY 95  Geobacillus k...
tigr:GBAA_3483  18 VCNIQNNEED-KEAFIVQYQPFIRKSISSVCRRYI-TEQDDEYSIGLFAFNEAIEQYSYKKGKSFLAFADLLIKRDVIDY 95  Bacillus anth...
BAC13058        15 VYAIQQGNKFlQNELLRTYQPFIAKCVSEVCKRYIdPKRDDEFSIGLSAFNEAIFSYVPNKGSSFLSFAKLVIKRKVIDY 94  Oceanobacillu...
AAM23422        10 VYIAKKDPSE-REKLIEEYTPFIIKQVSHFANKYIdEQNSDELSIGLIAFNEAIDSFDITKGS-FLNFSSLIIKRRIIDF 87  Caldanaerobac...
AAK79735        11 IQKAKESKEE-LNRLIQEYKPFIASLLQKKTGKYLqYGYDDELSIGMIAFEEAVESYDRNKGK-FLSFAKRVIILRAIDY 88  Clostridium a...
tigr:CHY_1519    1 MQPNNPINDEiFEQMIRQHESLIFGIAARLTGRFI-TKSDDEYSIGLLALSEAIQSYNSAKGVEFEKFAAQIIRRRLIDF 79  Carboxydother...
BAD75217        96 IRKEVRTrEAIWHVEDEEngeqaaQTYVDAKLSVEEFYRQIEQEQRREEILHYQQVLKQFGIHFHDLVEQSPKHKDARLN 175 Geobacillus k...
tigr:GBAA_3483  96 IRKESKH-NLVFLKEDEQ------EEMLEMQVSLTEYMKEIENGNRKEEILHFQSVLADFKITFSELAKESPKHRDTREH 168 Bacillus anth...
BAC13058        95 IRYQQKRtASLSLDETYDee--qmENSLEIAAVQEKYQMEIDAQNRKEEILEFKEKLKLYKLSLVELTEVSPKHRDARES 172 Oceanobacillu...
AAM23422        88 LRQNQ---DLAYPLDVYP-----------------ERESDYEIENRRLEMLSFVNLLSLYGIEIEDLVRQSPKHRETRKL 147 Caldanaerobac...
AAK79735        89 YRKNQKFkNIVYLQGNYDsen-ndINPIMFNKAMEQYKNKSINEIRRLEILEYKKELREWGIEFVNLVQASPKQEKLKKT 167 Clostridium a...
tigr:CHY_1519   80 YRQNKSYqQNLPLDESFL-----------------SQRNLIDEVDVRLEIAEYEKLLKQFNITFAELVKVSPKHNDSRQK 142 Carboxydother...
BAD75217       176 AIRVAELLVANDEWLGILFRKKQLPIKQLETMASVSRKTIERNRKYIIAVAVILAGDYIYLKDYI 240 Geobacillus kaustophilus HTA426
tigr:GBAA_3483 169 LIEIVKVIIKEEEMMEELFRKKKLPLKHIEPRVRVSRKTLERHRKYIIAMCIIFANNYTYILDYI 233 Bacillus anthracis str. 'Ame...
BAC13058       173 AVKTARILFNDPILREYVYRKKKLPIKDLVKKVDVSKKTLERNRKFILAMFIVLSEDYIYLKEYL 237 Oceanobacillus iheyensis HTE831
AAM23422       148 ALKIARTICENEHLLSYLKKTKTLPVKELIELLRISRKSIEKYRKYIIALVIILSEDLPILKEYI 212 Caldanaerobacter subterraneu...
AAK79735       168 YKNIANVIVHNQDILNKLIRVKRLPIKEIEKNIYINRKKLERGRIYIIALVIAEIGDYRLIREYI 232 Clostridium acetobutylicum A...
tigr:CHY_1519  143 LIMLAKGIAEDEEFVRQLIRTKKLPLQSISERFKIKQKTIEKYRKYLVAIILIYWGRFTGLQAYL 207 Carboxydothermus hydrogenofo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap