Conserved Protein Domain Family
spore_yabQ

?
TIGR02893: spore_yabQ 
spore cortex biosynthesis protein YabQ
YabQ, a protein predicted to span the membrane several times, is found in exactly those genomes whose species perform sporulation in the style of Bacillus subtilis, Clostridium tetani, and others of the Firmicutes. Mutation of this sigma(E)-dependent gene blocks development of the spore cortex. The length of the C-terminal region, including some hydrophobic regions, is rather variable between members. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131939
View PSSM: TIGR02893
Aligned: 11 rows
Threshold Bit Score: 86.949
Threshold Setting Gi: 15026279
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB03794       2 SLTIQFYTMLSMAAMGVWLGAAIDTYHRFSKRRRmLFHWLEFINDVLFWLIQGLILFYVLLQVNQGEIRFYIFLAILCGY 81  Bacillus halodu...
AAT63083       2 SLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQE-RKRWLVFIHDILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGF 80  Bacillus thurin...
BAD74339       2 NVSIQLYTMLAMIGMGGWLGLAWDTYSRMLKRHE-RAHWLVFVNDVLFWAVQALIVFYVLLFVNEGELRFYLFLALLCGY 80  Geobacillus kau...
P37559         2 TLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAK-TARWLLFIHDILFWIMQGLLFFYVLLHVNEGEFRIYIFLAVLLGV 80  Bacillus subtil...
BAD62640       2 ALTVQFYTMVAMAAMGICLGAAVDTYGRFLPRQR-TFRIHIALLDIAFWIVQALLVFYILFKTNQGDIRIYVFLALLCGY 80  Bacillus clausi...
BAC12025       2 TLSVQFITMISMVLSGFYLGIIQQTFRRLTTYWR-DNAFLTYFLEIGFWLTQAGVIFYVLYHVNAGEVRLYVLLACLLGF 80  Oceanobacillus ...
BAB82182       4 DINIQFKIVIFAILSGIIIGFLFDIYREFRGVCK--NKILITIEDILFWIWCSLIVFVFLLKYNYALIGVYVYVFMGITL 81  Clostridium per...
AAM25578       4 TIQSQIYSFLVTVYGGFILGALYDIFKVMRKVFH-LKKAFVPAADIIFWLISTVIMLYFLYMSNYIELRFYNFLGFLFGV 82  Caldanaerobacte...
AAK81144       4 SIYEQLIFFISNFVAGVIAALLFDVYRVLLVCEH-PNKIVTFLEDILFLVLDAIVVFVFLLYTNEAYINAYVYVFIILGL 82  Clostridium ace...
BAD42209       3 RMELQFYALFMTVLSGIGVGLLFDLLRAVRRFLR-PGPLLAALGDLLFWGAATAMVGTGLFLGNWGEYRFYVLVGLLTGL 81  Symbiobacterium...
WP_003359440   4 SISKQLGLLIFSFLSGLITGVFFDIYRSIRMDKN-LSPIIKIIEDILFWCLAAIVIFIFLLYNDCAFIGVYVYLWIAIGL 82  Clostridium bot...
BAB03794      82 AAYQALFRQVYQKLLERGIQFVLALYRFGRKMIHIFFVSPIKWLLNLLYRL 132 Bacillus halodurans C-125
AAT63083      81 AAYQSLLKAIYMRLLNFLIYIFVQTTHFFVQIIKLLMIKPVIIIAQLFIAF 131 Bacillus thuringiensis serovar konkukian str...
BAD74339      81 AAYQSLLRSFYVRVLEWFIGLAVRLGQTLVQLFRLMVMRPLILLGQMALAL 131 Geobacillus kaustophilus HTA426
P37559        81 ATYQSLCKRIYIKILKFVIYLVVSVYQFFKKLIQHVLFRPIVWTCGAIIWL 131 Bacillus subtilis subsp. subtilis str. 168
BAD62640      81 AAYQALFKGVYNWFVNLVITIVQAVLRFVWGLLKALIVMPIKWLLMSVRRL 131 Bacillus clausii KSM-K16
BAC12025      81 SIYQVFAKKPYIRMLEVIIRIVSSIYHFIRRLFDKLLLSPLKWIITLIYRM 131 Oceanobacillus iheyensis HTE831
BAB82182      82 VIYLKTLSKYFRRIQHKILAILLKNLRIIFKN--------IRYAFKNTFTN 124 Clostridium perfringens str. 13
AAM25578      83 LLYYFLLSEFVTEILIIVTTGIVNFFKFVAGILLKPFGTAIRFFKKPWDFA 133 Caldanaerobacter subterraneus subsp. tengcon...
AAK81144      83 CFYIKFISPLFVSVIRKFLNQFLKCVRILFKF--------IIYILECLFLS 125 Clostridium acetobutylicum ATCC 824
BAD42209      82 VLHFALASPAVLWLADRLLHAVAWVLKVLWELAMRLVWFPLQAVAAVLWRL 132 Symbiobacterium thermophilum IAM 14863
WP_003359440  83 YIYIFFISKYLNPIFIYVVQNINKFFRISINI--------IVYPFKILIYK 125 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap