Conserved Protein Domain Family
spore_YpeB

?
TIGR02889: spore_YpeB 
germination protein YpeB
Members of this family are YpeB, a protein usually encoded with the putative spore-cortex-lytic enzyme SleB and required, together with SleB, for normal germination. This family is retricted to endospore-forming species in the Firmicutes lineage of bacteria, and found in all such species to date except Clostridium perfringens. The matching phenotypes of mutants in SleB (called a lytic transglycosylase) and YpeB suggests that YpeB is necessary to allow SleB to function. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131935
View PSSM: TIGR02889
Aligned: 7 rows
Threshold Bit Score: 579.724
Threshold Setting Gi: 51857784
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO34933        7 RVIYTAIVTIIVVFSSTFAILMTLERTDYRNYLQAQYSKNMYELMDSVQNIRVNLSKAAVVGSREQNIIVFDEIFRHATN 86  Clostridium te...
AAK80838        7 RIAYTLAVSLIVVFSTSYAILMTLERTDYRNYLQGEYDKSMYQLIDSVENIGADLSKVPILGSREQNTLVLGDIYRYSTI 86  Clostridium ac...
AAM25674        3 KRWFTAFVLILVLALGAWGYRQYLEKISYHRYLQAQYDRSFYQLISNVENIETSMGKLMVASSDKTTISILDEIWREAFS 82  Caldanaerobact...
BAD41942        9 WLSVSLFAAVAVAVWAAWTANLNEHNRLLANALEAERQRNFVDMVHHVEQIQALLGKGLATGSERQNMRYMADVHRHASA 88  Symbiobacteriu...
P38490          3 RGILIAVLGIAIVGTGYWGYKEHQEKDAVLLHAENNYQRAFHELTYQVDQLHDKIGTTLAMNSQKSLSPALIDVWRITSE 82  Bacillus subti...
BAD64406        3 RNLLIAALAVAVVGTGVWGYQQKQEKNQLQITANNTYQRAFHDLTYHIDQIEDELGKTLAMNTQRQLTPSLADVWRVTSL 82  Bacillus claus...
tigr:CHY_1161   3 RTIAVILGSLLLVGLFIWGYDQSQKKNRLYWELNSQYRRAFEELYGHSKTLEAQVGKTLVSMSLQQNLKQAAKGWRQAYA 82  Carboxydotherm...
AAO34933       87 ANDRLHSLPLSQDTIENTSRFLSQVGDFCYTLGKTTSEGTQLQDKDYKNIEDLKNRSVKLEANLNQVSNDINEGKVRWGE 166 Clostridium te...
AAK80838       87 ANDKLHSMPIAQEQLQGTSKFISQLGDFCYVLENKSAKGEELSASDISQVERLRNQADSLENQLKDVQNNINLGRVGWGE 166 Clostridium ac...
AAM25674       83 GQEHLSQLPIGQPEIDNTSKFLVQVGDYAYSLTKKIASGGKLSDKDLKTITTLHNYAVFLGKNLHDLSKKV-QGGYELGN 161 Caldanaerobact...
BAD41942       89 AMTAFSSLPLPTEVSSTTGKFLQQVGDFAYALLRDEAAGRSLTEAERAELQRLREAAAALKEQLGTMLTQYQRGGFRWHQ 168 Symbiobacteriu...
P38490         83 AHNSVSQLPLTLMPFNKTEELLSKIGDFSYKTSVRDLDQKPLDKNEYTSLNKLYQQSEDIQNELRHVQHLVMSKNLRWMD 162 Bacillus subti...
BAD64406       83 AEKSLAELPVQELNMDDTEKYLFKIGDFTYRTSVRDLNKEPLTDKEYETLTQLYEQASSIRESMRKTQATVMQGGMQWLA 162 Bacillus claus...
tigr:CHY_1161  83 VVEDLGQLPVTTFSLEKTKAFYNQLGDFTYTVAIKDTEGKSLSPEERKTLATYYNELKKINNKLEKAVDILKNQPIMITK 162 Carboxydotherm...
AAO34933      167 IRKKVGGVLARNKEDISEQ----------------FKGIQKQVTQY--PALIYDGPFSDNVVEIEPRI---NKEKE-ISK 224 Clostridium te...
AAK80838      167 IRRKMSGVLASANGANISDs---------------FKNIQKQSAQY--PALIYDGPFSDNNLQITPKV---NSMGV-VSQ 225 Clostridium ac...
AAM25674      162 LRKQGTKKMAQIDSKILNVr---------------MNSVNQTMTNF--PTLIYDGPFSESLMKLTPKG---LTGPE-ISY 220 Caldanaerobact...
BAD41942      169 PAQLSLRTLMRPPGRVLSDpaasggpaaaalldggWAQLATSMEQM--PTFIYNGPFSDHVNQ-TPPA---LSGPQ-LSR 241 Symbiobacteriu...
P38490        163 VEMALASDEKQSDNTIINS----------------FKTVEKNVGAF--STGTDLGPSFTSTKK-EEKGfshLKGKQ-ISE 222 Bacillus subti...
BAD64406      163 QNDEQREDEPTQSSSVAGH----------------FERLNKSVQGF--SEVEW-GATDSAIRNLNGELkeaLAGKEkISK 223 Bacillus claus...
tigr:CHY_1161 163 ETKLYSLREDLMPEAIVNA----------------LRDVENNVLDLrnKKVAYEGDFVN--INPYPLG---IKGKP-VSM 220 Carboxydotherm...
AAO34933      225 EEAEKKIRTVIGENKVTK-IDLVNkESNTGISTYSFEVGVKGRNdksDRIVCEVSKKGGKILYLLDNRLVESSKIKRDTA 303 Clostridium te...
AAK80838      226 KEAESVVRKAIGENRIKS-IETTD-SGKAGIPMYAFNVSIKGRDknaSRVRCEVTKHGGKLITLLDNKTVSKSNIDMKKA 303 Clostridium ac...
AAM25674      221 DRALQIAREFYGKNIE---SESKYsPSNGKIKTYGVELKPSGK----PPVYINVSRKGGHVVWMMDERSPSKVNISASQA 293 Caldanaerobact...
BAD41942      242 EEAGGRLATALPDAAAYRvVDVVEsGGN--LPAYTFRLAPAGTRgsaYTATVSLTRQGGHLLEFLSGRVLGQPALDLEQA 319 Symbiobacteriu...
P38490        223 QEAKQIAERFAPDDNYS--IKVVKsGKKTNRDVYSISMKDPDHK---AVIYMDITKKGGHPVYLIQNREVKDQKISLNDG 297 Bacillus subti...
BAD64406      224 EEAKQRALDYLKLGEGTS-VQINDsPKALEYPAYSLSIDDPDNQ---ANYDMDMSVEGGEPIWFLQDRQIDKAKISLNEA 299 Bacillus claus...
tigr:CHY_1161 221 IEAKTIIKDFLGQEAAGR-MILPVtRVNGLIPTYLYEVIDRQAK---TKIYYNVSVNGGKILSFLTTRPTSSPSLTVNEC 296 Carboxydotherm...
AAO34933      304 MKKGEEFLKSIGYK--EMVPTYAIDYGNVATVSYVYKKDDIMIYPDQIKLKIALDDGSIVGIESAKYLVSHTNnRNIPKA 381 Clostridium te...
AAK80838      304 TDIGINYLNSLGFK--NMKSTYFLNYENVGVISYIYNQNNVSVYPDMIKLKVSLDDGSIVGVDAKKYLTSHVDtRNFGSP 381 Clostridium ac...
AAM25674      294 LKHAKKFLETHGFK--DMESTYSMKAPGSIQFNFVPVENEVYLYPDIVKVKVALDNGDIIGFDATAYYMNHVK-RKLEKP 370 Caldanaerobact...
BAD41942      320 RAVGQEYLARIGYA--DMVPTFAQIQDGVAFVAYVYQQGEVIVYPDQAKVKVALDNGEVLGVDARQYLTNHRR-RTLPRP 396 Symbiobacteriu...
P38490        298 SNRALAFLKKNGFEtdDLEIDESAQYDKIGVFSYVPVENKVRMYPEAIRMKVALDDGEVVGFSARDFLTSHRK-RTIPKP 376 Bacillus subti...
BAD64406      300 VNKAQNFLERGGKE--GMQLVESTQYDNVGVLEFAYVQDGVRIYPDNVMIEVALDDGDVISYVGRGHLIHHQEdRQIPEP 377 Bacillus claus...
tigr:CHY_1161 297 VQKAKKYLLKFGFG--NIEPTEIDKIDNELSITFVSKVGDILYYPKVIKVKVGMDKGDVTAFEGTQYYMYDRP-RPLNKL 373 Carboxydotherm...
AAO34933      382 KVSLEEARKKVGKRLKIKSSRLAIIPTETNK-EKLCYEFTGDYNGETFIVYVNAHTGYEERIIQI 445 Clostridium tetani E88
AAK80838      382 KVSQQTAQTKVGRRLNITSVNLAVVPTETNT-EVLTYEFVGSYKGQDFVEYIDANTGYETRILQI 445 Clostridium acetobutylicum AT...
AAM25674      371 KLTLEQAREKVNKNLKIESTKLALIPLEGGR-EVLAYEFKGTYRGDTFYVYINAINGNEEKILKV 434 Caldanaerobacter subterraneus...
BAD41942      397 RLTPDEARSRLNPHLEVSRVQLALIPDAAGTgEVLTYEFQGKIGDEVYLVYINAETGAEEQILQL 461 Symbiobacterium thermophilum ...
P38490        377 AITEAEAKSKLNKNVQVRETRLALITNELGQ-EVLCYEMLGTIENDTFRMYINAKDGSEEKVEKL 440 Bacillus subtilis subsp. subt...
BAD64406      378 KLTKEEAQAKVNKHVEIQEDHLAVIENDINE-EVFVYEFYGTRDNDTYRIFINALTGEEEKVERM 441 Bacillus clausii KSM-K16
tigr:CHY_1161 374 LLTEAKAKKNINPHLKILRTRKAVILNDRNQ-EILTYEFLGELLGEKYLIYVNTETGKEEKIVRL 437 Carboxydothermus hydrogenofor...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap