Conserved Protein Domain Family
spore_sigF

?
TIGR02885: spore_sigF 
RNA polymerase sigma-F factor
Members of this protein family are the RNA polymerase sigma factor F. Sigma-F is specifically and universally a component of the Firmicutes lineage endospore formation program, and is expressed in the forespore to turn on expression of dozens of genes. It is closely homologous to sigma-G, which is also expressed in the forespore. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131931
View PSSM: TIGR02885
Aligned: 8 rows
Threshold Bit Score: 358.644
Threshold Setting Gi: 20516321
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD40797          20 LVALARAGDKEARDRLVEGNLRLVRSLVSRFSASGADPEDLFQIGCIGLLKAIDRFDLNYDVRFSTYAVPLIMGEIRRHL 99  Symbiobacte...
AAK80262          20 LIKSVHEGNKEALNKIIENNLPLVSAISRKFLNRGYEYDDIFQIGCMGLVKAVNNFNSDYKVKFSTYAVPMIMGEIKRFL 99  Clostridium...
BAB81754          19 LIVMAKEGNKEAMNKLIEVNTPLVSSICKRFTNRGYDYEDIFQIGSMGLVKAINNFNDSFNVKFSTYAVPMIIGEIKRFL 98  Clostridium...
AAO36728          22 LLEKAKNGDKKATDKLVELNLPLVSAISKKFLNRGYDYEDIYQIGCMGLVKAINNFDSSYNVKFSTYAVPMIMGEIKRFI 101 Clostridium...
AAM24541           9 LIKLAKNNDKASLEKLILENSGLIWSIVKKFANRGYELEDLYQIGCIGFVKAVQKFDESYNVKFSTYAVPIIMGEIKRFL 88  Caldanaerob...
tigr:CHY_1959     24 LIEKAQKGDVAAREKLINCNLKLVFKVVERFLHRGYEVEDLFQIGTIGLIKAIDKFDLKQQVKFSTYAVPMIVGEIRRFL 103 Carboxydoth...
jgilanl:BCZK3829  22 LIQKSQDGDQQARDTIVQSNMRLVWSVVQRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQRFL 101 Bacillus ce...
BAC13795          20 LIRLSQQGDQSARDRLVEKNIRLVWSVVQRFINRGYDPDDLFQIGSIGLIKSIDKFDLSYDVKFSTYAVPMIIGEIQRFI 99  Oceanobacil...
BAD40797         100 RDDGPMRVSRSLKQLAQQARRVRERLAAQMERDPTVAEVAAELGVSPEEVVAALDGVRPPTSIHQTVHEGDGDPIYLLDQ 179 Symbiobacte...
AAK80262         100 RDDGIIKVSRSVKSTARQLHYDREKLVKELNREPTIDELSKFSGIDKEEIIMATESTTSMQYLYDVVHQDDGSPVLLIDK 179 Clostridium...
BAB81754          99 RDDGIIKVSRSTKTLAKKLHYNKEELIKKLNRDPTVDELAEYSGVDKEEVIVALESASSMQYLYDTIHHDEGTPVLLIDK 178 Clostridium...
AAO36728         102 RDDGIIKVSRSLKIMARKLYYHRETLCKKLGREPSIEELSEYTGLEIEEIVYAMESSSNLQYLHDVIHQDDGAPIMLIDK 181 Clostridium...
AAM24541          89 RDDGLIKVSRSLKELSSKAFYMKEVLSNELNREPTINEIAERLNVTPEEIAMAFESAATAESLYDSISHEEEDR-QLIEM 167 Caldanaerob...
tigr:CHY_1959    104 RDDQAIRISRSTKELGVKILKEKEALTVKLGREPTIAELEETLGYSREAIVEALEAGQSLASLFETVHQDDGDPIYLLDQ 183 Carboxydoth...
jgilanl:BCZK3829 102 RDDGSVKVSRSLKETGNKIRKMRDELSKEFGRAPTINEVAEALELTPEEVVLAQEASRAPSSIHETVYENDGDPITILDQ 181 Bacillus ce...
BAC13795         100 RDDGSIKVSRSLKEIGNKIRRKKDEMTKQYGRSPTVNELAEALELQPEEVVHAQEAAKSPQSIYETVFENDGDPITLLDQ 179 Oceanobacil...
BAD40797         180 LaADDGQREGVWLDRVALREGLNQLDERERTVILLRFFRDKTQTEVASILGCSQVQVSRLERRALERIRNYV 251 Symbiobacterium the...
AAK80262         180 L-SDPYSEDSDVIDKIVLKQIIKSLDNKSKQIIMLRYFKDKTQTQVANMLGISQVQVSRIEKRILKAIREKL 250 Clostridium acetobu...
BAB81754         179 L-SEK-GEDDDMVNKIALREAISSLDSKGKQIIMLRYFKDKTQIQVAKMLGISQVQVSRIEKKVLKIMKEKL 248 Clostridium perfrin...
AAO36728         182 I-SENYSEDSDIINKLALKEALGKLDAKSRQIIMLRYFKDKTQIEVAKMLGISQVQVSRIEKRVLKTMKEKL 252 Clostridium tetani E88
AAM24541         168 V-GDK-EDSVDLEEKLTLHMIIDKLKPREKQVIFLRYFKDMTQTEVANILGISQVQVSRIEKKVLEKIRKEL 237 Caldanaerobacter su...
tigr:CHY_1959    184 I-KQEGDEEQTLLENISIKEVLSKLEPRERYILINRFFKEKTQMEIARTLGISQVQVSRLERQALLKLKRYL 254 Carboxydothermus hy...
jgilanl:BCZK3829 182 I-ADQ--SETKWFDKIALKEAIRELDERERLIVYLRYYKDQTQSEVAERIGISQVQVSRLEKKILKQMKDRI 250 Bacillus cereus E33L
BAC13795         180 I-ADQ---DSKWFEKLSLQEAIRSLTERERLIIYLRYYKDKTQTEVAERLGISQVQVSRLEKKILEDMKKNM 247 Oceanobacillus ihey...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap