1W1B,2J13


Conserved Protein Domain Family
spore_pdaA

?
TIGR02884: spore_pdaA 
Click on image for an interactive view with Cn3D
delta-lactam-biosynthetic de-N-acetylase
Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores in the peptidoglycan wall, or spore cortex. The proteins in this family are PdaA (yfjS), a member of a larger family of polysaccharide deacetylases, and are specificially involved in delta-lactam biosynthesis. PdaA acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the following transpeptidation for lactam ring formation, as heterologous expression in E. coli of CwlD and PdaA together is sufficient for delta-lactam production. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131930
View PSSM: TIGR02884
Aligned: 10 rows
Threshold Bit Score: 388.293
Threshold Setting Gi: 15026067
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W1B_1    24 NWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQ 103 Bacillus subtilis
AAM25184  72 GWGLRVLPNHQTPEITPYAMELVKKYNAIFVGDTTKKVVYLTFDEGYEAGYTPRILDVLKENGVKAAFFVTGPYVKQQAD 151 Caldanaerobacter su...
AAO36733  84 DWFFEPKKDGSPSTVPNDVENVIKNHSTYFLGDTSEKVIYLTFDEGYENGYTSKILDVLKANDVKAAFFVVTPYIKTNKD 163 Clostridium tetani E88
BAD74712  35 HWGFKRSENHEPPSAGKELDELLAKYDAFYLGDTSEKTIYLTFDNGYENGYTAQILDVLKEKHVPAAFFVTGHYLQTAPD 114 Geobacillus kaustop...
AAT62309  32 NWGIPRPKNETVPDAGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGHYIKTQKD 111 Bacillus thuringien...
BAC12836  27 GWGYSKNSNHEIPDIGS-YQALLDKYNAYYVDDSGEKVLYLTFDNGYEQGYTDEILDVLKEEKVPATFFVTGHYVKSKPD 105 Oceanobacillus ihey...
BAD63834  30 NWSYKPAPAHTPADTEPMYKELLEKADGYFIGDRDSKSLYLTFDNGYENGYTEKVLDVLKEKQVTGAFFVTGHYLKTAPE 109 Bacillus clausii KS...
BAB81573  38 NWYYSFNKEEGVPH-GPKETPYISNHKVVYCGDTSKKEIFLTFDEGYENGNTAKILDILKENQVPAAFFVTRPYIKDYPD 116 Clostridium perfrin...
AAK80950  67 EWYYMNKGKASEQGPPKETSEYVPKYNCYYIGDSSKKVIYLTFDEGYERGYTPKILDVLKKHKAKAAFFVVKPYITSSPE 146 Clostridium acetobu...
2J13_A    19 NWGIPRPKNETVPDAGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGHYIKTQKD 98  Bacillus anthracis ...
1W1B_1   104 LIKRMSDEGHIIGNHSFHHPDLTTK---TADQIQDELDSVNEEVYKITGKQdNLYLRPPRGVFSEYVLKETKRLGYQTVF 180 Bacillus subtilis
AAM25184 152 LVKRMVEEGHIVGNHTVNHPSLPTL---PDEKVKEEILGLEKMFEDLTGQK-MKYFRPPRGEYSERTLYITKSLGYRTVF 227 Caldanaerobacter su...
AAO36733 164 LIKRMVDEGHLVCNHSVHHPSMAQValkGKEKFKEEFTGVEEIFKEVTGKEmPKFFRPPMGKYSELSLAYTKELGYKTIF 243 Clostridium tetani E88
BAD74712 115 LVKRMAAEGHIIGNHSWHHPDLTAA---SEERFREELEKVKEKTEELTGQKgMAYLRPPRGIFSERTLSLARDLGYYHVF 191 Geobacillus kaustop...
AAT62309 112 LLLRMKDEGHIIGNHSWSHPDFTAV---NDEKLREELTSVTEEIKKVTGQKeVKYVRPPRGVFSERTLALTKEMGYYNVF 188 Bacillus thuringien...
BAC12836 106 LIKRMVDEGHIIGNHSYHHPDFTIM---NKQAIQKEVEELEAAVAEVSDQKeMMYLRPPRGVFNEDTLKWSNELGLVHIF 182 Oceanobacillus ihey...
BAD63834 110 LVKRMVAEGHIVGNHSYHHPSLPQT---SDAKLAAELDDVKTLFTEITGETeMRYLRPPRGEFSERTLMKSKELGYTNVF 186 Bacillus clausii KS...
BAB81573 117 LIKRMDEEGHLVCNHTSHHPSMAKIl--DKEKFTKEFTEVEEEYSKVTGKEmPKFFRPPMGKYSEQSLAYTEELGYTSVF 194 Clostridium perfrin...
AAK80950 147 IVKRMEKEGHYVCNHSVHHKSMPSIy--DEAKFKSELDGVEEEYKKVTGKEmPKYFRPPMGKYSELSLYYTQKLGYKTIF 224 Clostridium acetobu...
2J13_A    99 LLLRMKDEGHIIGNHSWSHPDFTAV---NDEKLREELTSVTEEIKKVTGQKeVKYVRPPRGVFSERTLALTKEMGYYNVF 175 Bacillus anthracis ...
1W1B_1   181 WSVAFVDWKInNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLM 247 Bacillus subtilis
AAM25184 228 WSLAMADWQP-LPGGPEESYSTVMKRLHPGAVILLHAVSKDNAQALDRIIKSIKEEGYEFKTLDDIP 293 Caldanaerobacter subterraneus su...
AAO36733 244 WSFAYNDWNVdKQPNPEAAKKRIVDKAHNGAIYLLHAVSKTNTEVLDSVIKELKDKGFRFASLEELK 310 Clostridium tetani E88
BAD74712 192 WSLAFVDWQTdRQRGWQYAYDQIMKQIHPGAILLLHSVSKDNAEALPKVIDDLRKQGYTFASLDELM 258 Geobacillus kaustophilus HTA426
AAT62309 189 WSLAFLDWKVdEQRGWQYAHNNVMTMIHPGSILLLHAISKDNAEALAKIIDDLREKGYHFKSLDDLV 255 Bacillus thuringiensis serovar k...
BAC12836 183 WSLAFMDWNTdGQKGWQYAHGQIMDQIHPGAIILLHAVSSDNAKALKQVVKDLKEQGYTFKSLDHLM 249 Oceanobacillus iheyensis HTE831
BAD63834 187 WSLAYKDWEVdKQKGGKYAYDQVMKRIHPGAIMLIHAVSPDNAEALPDIIDECRRQGYTFRSLDELS 253 Bacillus clausii KSM-K16
BAB81573 195 WSFAYKDWLVdEQPSKEAAKKKILDKVHNGEVALLHAVSDTNTAILDEILKELKSNGYEFKSLNDLT 261 Clostridium perfringens str. 13
AAK80950 225 WSFAYGDWEPdHQPGKAEAKKKILEKTHNGTVLLLHAVSKTNADVLDELLTHWEKEGYKIGTLDDLT 291 Clostridium acetobutylicum ATCC 824
2J13_A   176 WSLAFLDWKVdEQRGWQYAHNNVMTMIHPGSILLLHAISKDNAEALAKIIDDLREKGYHFKSLDDLV 242 Bacillus anthracis str. Ames
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap