Conserved Protein Domain Family
QoxB

?
TIGR02882: QoxB 
cytochrome aa3 quinol oxidase, subunit I
This family (QoxB) encodes subunit I of the aa3-type quinone oxidase, one of several bacterial terminal oxidases. This complex couples oxidation of reduced quinones with the reduction of molecular oxygen to water and the pumping of protons to form a proton gradient utilized for ATP production. aa3-type oxidases contain two heme a cofactors as well as copper atoms in the active site. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131928
View PSSM: TIGR02882
Aligned: 3 rows
Threshold Bit Score: 1079.88
Threshold Setting Gi: 22777939
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD77743         2 KWSEFFV--TGEPLIYAADVAIVLTMVGIVFVLTYFKKWKWLWNEWLTTVDHKKIGVMYIICAVLMLFRGGVDALLMRAQ 79  Geobacillus k...
BAC14210         3 ILERFAIppHDDPMLYASLVAIALVSIAVVVGITYFKKWGYLWNEWLTTVDHKRIGIMYIISALLMLFRGGADGVMMRLQ 82  Oceanobacillu...
tigr:SACOL1069   4 PWDQLLV--KGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGVMYLICAVLMFVRGGIDALLIRAQ 81  Staphylococcu...
BAD77743        80 LTAPNMKFLDAQHYNEIFTTHGTIMILFMAMPFIIGLMNIVVPLQIGARDVAFPYLNALSFWLFFFGAMLFNISFVIGGS 159 Geobacillus k...
BAC14210        83 TSVPDNSFLDAQHYNEVFTTHGVVMIFFMAMAFIIGLMNYVIPLQIGARDVAFPRLNALSFWLYFAGAMLFNISFVVGGS 162 Oceanobacillu...
tigr:SACOL1069  82 LTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWNIVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGS 161 Staphylococcu...
BAD77743       160 PDAGWTAYFPLAGNEFSHGVGNNYYAVALQISGIGTLMTGINFLVTILKMRAPGMTLMRMPMFTWTILITCVLIIFAFPV 239 Geobacillus k...
BAC14210       163 PDAGWTNYYPLAGPEFSEHVGVNYYNWALQISGIGTLMTGINFVVTIMKMRAPGMKLMKMPMFTWSALITNIIIVFAFPV 242 Oceanobacillu...
tigr:SACOL1069 162 PAAGWTNYAPLAG-EFSPGPGVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP 240 Staphylococcu...
BAD77743       240 LTVALALMTFDRLFDTQFFTMANGGMSMLWANLFWIWGHPEVYIVILPAFGIFSEVVSTFAQKRLFGYKAMVGSIVGIAF 319 Geobacillus k...
BAC14210       243 LTIALLMGTLDRQFFTNFFTTSDGGMDMMWANLFWIWGHPEVYILILPAFGIYSQIISTFSQRNLYGYKSMVASMVIISL 322 Oceanobacillu...
tigr:SACOL1069 241 LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTFARKRLFGHQSMVWATAGIAF 320 Staphylococcu...
BAD77743       320 LSFIVWVHHFFTMGAGPAVNSAFSITTMAIAIPTGVKIFNWLFTLRKGKIRFTTAMLWSLAFIPNFVIGGVTGVMLAMAA 399 Geobacillus k...
BAC14210       323 LSFVVWVHHFFTMGQGALTNSIFSITTMAIAVPTGIKIFNWLLTMWKGKIRFTTPMLYSIAFIPLFTIGGVTGVMLSIAS 402 Oceanobacillu...
tigr:SACOL1069 321 LSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFNWLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMAS 400 Staphylococcu...
BAD77743       400 ADYQYHNSYFLIAHFHYVLIAGTVFACFAGLHYWYPKMFGHILNERLGKWTFWLFMIGFNICFFPMYFLGLMGMTRRMYT 479 Geobacillus k...
BAC14210       403 ADYQYHNTMFLVAHFHNVIIPGVVFAMIAGLIYYWPKMFGFLLNERIGKWAFWNIVIGFCLSFFPMYITGLDGQARRMYT 482 Oceanobacillu...
tigr:SACOL1069 401 ADYQYHNTYFLVAHFHYTLVTGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT 480 Staphylococcu...
BAD77743       480 YSAGLGWTPLNVVATVGAVLMGIGFIVLCYNIYYSARYGERDMTGDPWN--GRTLEWATASP-PVHYNFPVTPVVEDVDA 556 Geobacillus k...
BAC14210       483 YSEASGFGPLNLLSFGGVALLTLGFILLVYNIYYSFRHAPRNVGDDPWN--ARSLEWATHNP-VPEYNFAVTPTVDSEEA 559 Oceanobacillu...
tigr:SACOL1069 481 YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDglGRTLEWTTASAiPPKYNFAITPDWNDYDT 560 Staphylococcu...
BAD77743       557 YWVMKKKYGGFQvkEEDLKPIHMPSNSGRPFWMSVAFFVAGFGLVFKWFALAIVGALFIVLGLILRSFEDDDGYYIPVDE 636 Geobacillus k...
BAC14210       560 FWDYKKNGYKLF--KEPISDIHMPNNSGWSIILAGFFFIFGFFFVFHVWAGVIVGAIGILGCLLYRTFEKDDGHHIHKEE 637 Oceanobacillu...
tigr:SACOL1069 561 FVDMKEHG-RHYldNHNYKDIHMPNNTPVGFWIGIFMTIGGFFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAE 639 Staphylococcu...
BAD77743       637 IKRMEQAA 644 Geobacillus kaustophilus HTA426
BAC14210       638 IIETEKKF 645 Oceanobacillus iheyensis HTE831
tigr:SACOL1069 640 VAETEARL 647 Staphylococcus aureus subsp. aureus COL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap