Conserved Protein Domain Family
spore_V_K

?
TIGR02881: spore_V_K 
stage V sporulation protein K
Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 163057
View PSSM: TIGR02881
Aligned: 7 rows
Threshold Bit Score: 459.573
Threshold Setting Gi: 20516372
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27643         51 IEKEMSALVGMEEMKRNIKEIYAWIFVNQKRAEQGLKVGKQALHMMFKGNPGTGKTTVARLIGKLFFEMNVLSKGHLIEA 130 Bacillus subti...
AAM24588       37 ALRELNSLIGLHKVKEIIYEIYAFSQLQMKRKKEGLATDPIVLHMIFKGNPGTGKTTVARILGKLLKGIGVLEKGHVVEV 116 Caldanaerobact...
tigr:CHY_1391  28 LLKELDRMVGLIEVKEMVFEIYALAQIHKKRVQEKLKTNNVSWHMVFKGNPGTGKTTVARIIGKLFKEIGILTKGHLIEV 107 Carboxydotherm...
BAB06082       46 MERELKKYVGLDEVKRLIKEVYAWIYINQCRTEQGLRASKQALHMIFKGNPGTGKTTVARLIARFFRDMNVLSKGQLIEA 125 Bacillus halod...
BAD64716       45 FEQKLSAYIGLDEIKALIQELYAWIYVNERRKERGLKATKQVLHMIFKGNPGTGKTTVARIVASFLHEMNVLSKGHLLEM 124 Bacillus claus...
BAC13603       44 VDREFSSFVGLKDLKTSIKEIYASILINEKRKESGLKDSKQVLHMLFKGNPGTGKTTVARKLAKIYYEMNILSKGHFIEA 123 Oceanobacillus...
BAD40730       61 VIAELERMVGLGQVKALVRELQAYIAIQLRRAKAGLASEPGSLHMIFTGNPGTGKTTVARLLGRLFKEMGVLPKGHTVEV 140 Symbiobacteriu...
P27643        131 ERADLVGEYIGHTAQKTRDLIKKSLGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHEFILILAGYSREMDHFLS 210 Bacillus subti...
AAM24588      117 ERADLVGEYIGHTAHRVRENVKKALGGILFVDEAYSLARGGEKDFGKEAIDTLVKEMEDNRNKFILILAGYKYEMEYFLN 196 Caldanaerobact...
tigr:CHY_1391 108 ERADLVGEYIGHTALKTREQLKKALGGVLFIDEAYSLARGGDKDFGREAIDVVVKGAEDYRDNLVIILAGYYDEMNYLLE 187 Carboxydotherm...
BAB06082      126 ERADLVGEYIGHTAQKTRELIKKAQGGVLFVDEAYSLARGGEKDFGKEAIDTLVKAMEDQQHEFVLILAGYSDEMDYFLS 205 Bacillus halod...
BAD64716      125 ERADLVGEYIGHTAQKTREVLKQASGGVLFIDEAYSLSRGGEKDFGKEAIDTLVKGMENNSNDFVLIIAGYSKEMDYFLS 204 Bacillus claus...
BAC13603      124 ERADLVGEYIGQTAQKTRAIIQRAMGGVLFIDEAYSLSRGGEKDFGKEAIDTLVKHMEDQHQDLVLILAGYPYEMERFLT 203 Oceanobacillus...
BAD40730      141 ERADLVGEYIGHTAQRTRDVVRRALGGLLLVDEAYALARGGEKDFGKEAIDHLVRAMEEHRGELVVIFAGYPDEMAWFLR 220 Symbiobacteriu...
P27643        211 LNPGLQSRFPISIDFPDYSVTQLMEIAKRMIDEREYQLSQEAEWKLKDYLMTVKsttSPIKFSNGRFVRNVIEKSIRAQA 290 Bacillus subti...
AAM24588      197 TNPGLRSRFPIQIDFPDYTIEELLQIAEVMVKNRQYKLTESAKRKLMKILIKND---ASREMGNARMVRNIIEKAIRKQA 273 Caldanaerobact...
tigr:CHY_1391 188 QNPGLKSRFPIEITFPDYTDEELFFIAEKFLEDWEYLFSSEAAFYLKYKLKHLDq--SKKSSGNARLIRNIIEKAIRRQA 265 Carboxydotherm...
BAB06082      206 LNPGLPSRFPIAMDFPNYTTDQLMQIVKNMVKEREYQLTKRAQHLIREHVTKVRq-yEGRTFSNGRYIRNMIEEAIRRQA 284 Bacillus halod...
BAD64716      205 LNPGLPSRFPISITFPNYNVDELMEMLIGMAKERDYMLSEEALQECREHIRKVAs-eQERTFSNGRYIRNMVEEAIRQQA 283 Bacillus claus...
BAC13603      204 FNPGLESRFPFILEFDDYDVEELMEIAKRMVDEREYKFTREAEWKLRNHLARKVr-aSSVNFSNARYVRNVIERAIRLHA 282 Oceanobacillus...
BAD40730      221 QNPGLRSRIALTLHFPDYTAEELIAIAEQMLEQRDYRLTPDGKAALRQILYGNPw-lTAGENGNARAVRNLVERAIRRQA 299 Symbiobacteriu...
P27643        291 MRLLMGDQYLKSDLMTIKSQDL 312 Bacillus subtilis subsp. subtilis str. 168
AAM24588      274 VRVLNKVNITKEDLITIDSIDI 295 Caldanaerobacter subterraneus subsp. tengcongensis MB4
tigr:CHY_1391 266 VRLLGKSKVTKEDLLVLEKEDL 287 Carboxydothermus hydrogenoformans Z-2901
BAB06082      285 VRLLQEGSYSREALLLLKAEDF 306 Bacillus halodurans C-125
BAD64716      284 VRILKQNDYRKTAMELLKKEDF 305 Bacillus clausii KSM-K16
BAC13603      283 VRLLSEDNYSSNDLMLLTGEDM 304 Oceanobacillus iheyensis HTE831
BAD40730      300 LRLVDRSDASRAELMAITRADL 321 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap