Conserved Protein Domain Family
spore_ypjB

?
TIGR02878: spore_ypjB 
sporulation protein YpjB
Members of this protein, YpjB, family are restricted to a subset of endospore-forming bacteria, including Bacillus species but not CLostridium or some others. In Bacillus subtilis, ypjB was found to be part of the sigma-E regulon, where sigma-E is a sporulation sigma factor that regulates expression in the mother cell compartment. Null mutants of ypjB show a sporulation defect. This protein family is not, however, a part of the endospore formation minimal gene set. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131925
View PSSM: TIGR02878
Aligned: 5 rows
Threshold Bit Score: 322.879
Threshold Setting Gi: 1730928
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P54393          27 SLEELNDLSDTVFQMTRQAKYEEALQVLEYFEKTLKSAEKkQQDPmLTGAQIRQITLGYNDMVRSLKQADTSDTQKLRAA 106 Bacillus subt...
BAB05395        30 TWKELNRTSDQVLQLVKQEKLEEAKQLLDYFQTQFVKADY-EDRK-LSMTSLRTVTTSYERANQAVTATNMGLDERIRHV 107 Bacillus halo...
BAD64446        28 AWKELNHTANQVLKLTKEQRYEDGKRLMSVFADFFLSYDF-EDQE-WTMSSLRTLTTTFENAEDALTATNMPDDERIRLV 105 Bacillus clau...
BAD76473        29 GWEQLDDISDEALQLAKNGRFAEAKEVLRYFSKRFFALG--AKERlKSADELRAVTVTHEQAVKAMTAP-ISAEDKVAAI 105 Geobacillus k...
tigr:GBAA_1550  24 EWSELTGLLDDSLQLVKRNEDEKAVQVLQHFSEQFVIKGN-EKKQeVTPDQVRVISLAYDRAKQSLAEEDVRKQVKIDNV 102 Bacillus anth...
P54393         107 AQFRMLMDAVDNRSDPLWGSLEKPIMEAFTELKRDVQKNGSTSFHEKWNEFISLYDLIYPSLTIDVSEDQLETVGKHIDV 186 Bacillus subt...
BAB05395       108 TEFRLVVDAIVSEHHPLWLHSETSIMHALTRMKEAIQTEDHQGFQHRLNEFLNHYQMIRPSLTITLEPAHLQQVESQVSY 187 Bacillus halo...
BAD64446       106 TAFRLAIDAFAKNSEPLWKSTEAQVMASLDDLEEAAVSKDAQALKRQINAFHSLYGMIRPSIHISTTEQTVVRFDSYFAL 185 Bacillus clau...
BAD76473       106 TQFRLVVDAIHSTYQPLWTEMEPAVMEAFAAVEKAAQQGEQKAYAAALRQLLDRYTLIEPSVKIDVPPDIATKVDDDLEA 185 Geobacillus k...
tigr:GBAA_1550 103 LALQLAVDAQVSKYQPLWMEREGKVMDAFSQMEKAMKKEDTGQFQQTLNTFLHEFNIIYPSLMIALPENEVQRVNAHLSY 182 Bacillus anth...
P54393         187 IEQEEfQQMTESTKLERLSLLQHDLKNVFDRVEEDDADPSLLWVIITTGSIIITALTYVGYRKYKAEKNKLKKR 260 Bacillus subtilis s...
BAB05395       188 MENFR-MERSADEVENHLNLMEETFTALFAQVKEDSADPSLLWVMFTIGGMIIASLSYAGWRKYKGEKSKVKVK 260 Bacillus halodurans...
BAD64446       186 LENQ---SVSPEQLEDHIETMRGAFKELYDGSGEDGIDPSLLWAILSIGGPLVASLSYVGYRKYRAEKRRVKAK 256 Bacillus clausii KS...
BAD76473       186 LQAAAfWQRGEDEQREQLADARQDLEALFAGVKKDEADPSLIWVMISTGGVIVLTLTYVGWRKYKGEKEEKRAR 259 Geobacillus kaustop...
tigr:GBAA_1550 183 LDEFRnVMLKTKGGQMQLGIIKGDLQKIFHTVKKDEIAPSLIWFMTITGGLILFTLTYVGWRKYKGEREKRKSN 256 Bacillus anthracis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap