Conserved Protein Domain Family

TIGR02875: spore_0_A 
sporulation transcription factor Spo0A
Spo0A, the stage 0 sporulation protein A, is a transcription factor critical for the initiation of sporulation. It contains a response regulator receiver domain (pfam00072). In Bacillus subtilis, it works together with response regulator Spo0F and the phosphotransferase Spo0B, both of which are missing from at least some sporulating species and thus not part of the endospore forming bacteria minimal gene set. Spo0A, however, is universal among endospore-forming species. [Cellular processes, Sporulation and germination]
PSSM-Id: 131922
Aligned: 5 rows
Threshold Bit Score: 446.162
Threshold Setting Gi: 51856659
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
AAO36116         249 YTIHNDKGKPTNSEFIAMVADKLRLKNKVS 278 Clostridium tetani E88
AAM24528         231 YTINDEKGKPTNSEFIALIADKLRLGMKAG 260 Caldanaerobacter subterraneus subsp. tengcongensis MB4
jgilanl:BCZK3925 247 YTVSMSKAKPTNSEFIAMVADKLRLEHKAS 276 Bacillus cereus E33L
tigr:CHY_1978    234 YTIDVERGKPTNSEFIAIIADRLRLEAKVS 263 Carboxydothermus hydrogenoformans Z-2901
BAD40817         230 RGAEGRRTKPSNSEFIAAVVDRLRAGSAAG 259 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap