Conserved Protein Domain Family

TIGR02874: spore_ytfJ 
sporulation protein YtfJ
Members of this protein family, exemplified by YtfJ of Bacillus subtilis, are encoded by bacterial genomes if and only if the species is capable of endospore formation. YtfJ was confirmed in spores of Bacillus subtilis; it appears to be expressed in the forespore under control of SigF (see ). [Cellular processes, Sporulation and germination]
PSSM-Id: 131921
Aligned: 7 rows
Threshold Bit Score: 189.179
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAB14928       83 GGVSITPIAFLIVGSTGIRMLHLDENThLIEKILDAAPQTLERIQQMFKKNN 134 Bacillus subtilis subsp. subtilis str. 168
tigr:CHY_1943  76 AGVSVQPVGFLVVGKGQIRLLPVDTNA-LVDKLIDLTPELLAKIQNFVGNNR 126 Carboxydothermus hydrogenoformans Z-2901
AAM24551       82 AGVSVQPVAFMVVGQGQIRLLPVTQSA-MLERIIDLTPKLLEEIQNLFSKGK 132 Caldanaerobacter subterraneus subsp. tengc...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap