Conserved Protein Domain Family
spore_ytfJ

?
TIGR02874: spore_ytfJ 
sporulation protein YtfJ
Members of this protein family, exemplified by YtfJ of Bacillus subtilis, are encoded by bacterial genomes if and only if the species is capable of endospore formation. YtfJ was confirmed in spores of Bacillus subtilis; it appears to be expressed in the forespore under control of SigF (see ). [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131921
View PSSM: TIGR02874
Aligned: 7 rows
Threshold Bit Score: 189.179
Threshold Setting Gi: 77994844
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB14928        3 DHPIQGLMKTAMENLKEMIDVNTIIGDPVETPDGSVILTVSKVGFGFAAGGSEFGGKPAEKKSeddetrEQKLPFGGGSG 82  Bacillus subti...
BAC14150        3 QHPIEGLMTTAMESIQKMIEVNTIIGDPVKTHEGTVIIPVSKVGFGFAAGGSEFSPSQIYSDEn----rQQEMPFGGGSG 78  Oceanobacillus...
tigr:CHY_1943   5 HHPIESLMKTAMESIKEMVDVDTVVGSAVETPDGSVIIPVSRVTLGFAAGGSEFSTGEGKEKS---------LPFGGGSG 75  Carboxydotherm...
AAM24551        3 DHPIDALMKTTMESLKDMIDVNTIVGDAVETPDGTIIIPISRVTFGFAAGGGEINLSKGDKKGtdq-esSQSMPFAGGSG 81  Caldanaerobact...
AAK80018        3 NNPIENFMRTTMENIKGMIDVNTIVGEPIKNTDGSLIIPISKVSFGFASGGSEFKSQEDSQEN------KKIYPFGGGAG 76  Clostridium ac...
AAO36078        3 NHPIENLMQSTMENIKNMVDVNTIVGNTILTPDGASIIPISKVSFGFASGGSEYNSSISSDLG--------KYPFGGGSG 74  Clostridium te...
WP_003402813    3 GHPIENLMKNTMENIKDMIDVNTIVGDALNSPDGTTIVPISKVSFGFASGGSEYLSEKQNEND-------LNYPFGGGSG 75  Clostridium bo...
CAB14928       83 GGVSITPIAFLIVGSTGIRMLHLDENThLIEKILDAAPQTLERIQQMFKKNN 134 Bacillus subtilis subsp. subtilis str. 168
BAC14150       79 GGVSITPVAFLVIGEKGMEMIHLDQHThLYEKLIDSAPQLVEKMKKLMKENE 130 Oceanobacillus iheyensis HTE831
tigr:CHY_1943  76 AGVSVQPVGFLVVGKGQIRLLPVDTNA-LVDKLIDLTPELLAKIQNFVGNNR 126 Carboxydothermus hydrogenoformans Z-2901
AAM24551       82 AGVSVQPVAFMVVGQGQIRLLPVTQSA-MLERIIDLTPKLLEEIQNLFSKGK 132 Caldanaerobacter subterraneus subsp. tengc...
AAK80018       77 AGVSLKPIAFLVIKDDSVRLLPLNAEN-TYEKVVDMIPQLIEMCKG-FSHKS 126 Clostridium acetobutylicum ATCC 824
AAO36078       75 AGVSLKPVAFLFIKSDSVRLLPVDQTT-PYDRVIDTVPQLVDMFKD-MSKSK 124 Clostridium tetani E88
WP_003402813   76 AGVTVKPVAFLVIKGDQIRLLSVDHKN-TYEKLIDNVPQIMDMLKDKFGYNK 126 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap