Conserved Protein Domain Family
spore_ylxY

?
TIGR02873: spore_ylxY 
probable sporulation protein, polysaccharide deacetylase family
Members of this protein family are most closely related to TIGR02764, a subset of polysaccharide deacetylase family proteins found in a species if and only if the species forms endospores like those of Bacillus subtilis or Clostridium tetani. This family is likewise restricted to spore-formers, but is not universal among them in having sequences with full-length matches to the model. [Energy metabolism, Biosynthesis and degradation of polysaccharides, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131920
View PSSM: TIGR02873
Aligned: 4 rows
Threshold Bit Score: 499.395
Threshold Setting Gi: 22777288
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC13561        45 DELYMEIEQKSKEYKEEPQNAYIDNVWKKTPGRNGRQVDVNASYKKMKdEENRFNDDLFVFDEISPEVSLDELPASPIYR 124 Oceanobacillu...
tigr:GBAA_3943  27 DNLYEEIQKHAKQYEIAPQNAMIDKIWKATPGYNGRQVDMEASYNNMK-KLKKFDQKHLEFKEVSPSVHLEDLSPAPIYR 105 Bacillus anth...
P50850          46 DPLYEELLQKAPEYEVKPQNARIDKVWKSIPGYNGLKVNIEQSYKKMK-QHGKFREKDLVYSQVKPSVHLESLQPEPIYK 124 Bacillus subt...
BAB06125        46 DSLYEEIKDRAPEYEQPAIDAKIDRVWKAIPGYNGLEVDVESSYNRMK-QEGRFDERYLVFRETKPSVHLDDLPPSPVFR 124 Bacillus halo...
BAC13561       125 GHPEKQMTAFLINVSWGEEYIPEILQVLKKHEVKATFFIEGKWAKENSEIVQMIDEQGHLIGNHAYNHPDMATLSKEEAY 204 Oceanobacillu...
tigr:GBAA_3943 106 GHPNKKMVGLTINVAWGNEYLPRILEILKKHDVKATFFLEGRWVKENLRFAKMIVDANQEVGNHSYTHPNMKTLSSDEIR 185 Bacillus anth...
P50850         125 GNPDKPMVAFLINVAWGNEYLEKMLPILQKHQVKATFFLEGNWVRNNVQLAKKIAKDGHEIGNHSYNHPDMSKLTTGRIS 204 Bacillus subt...
BAB06125       125 GNPEKPMVTLLVNVAWGNEHLPTMLKTMNKYDVKSTFFLDGSWVKKHPQLATMIVEEGHEIGNHAYSHPDMQRLTRERMD 204 Bacillus halo...
BAC13561       205 DQINQTNQILNAVIGETPKWFAPPSGSFNDNVVQTAADLNMETILWTVDTIDWKNPSVSVMVNRIREKIHPGATVLMHPT 284 Oceanobacillu...
tigr:GBAA_3943 186 DQLQKTNRMIEAATNQKVRWFAPPSGSFRDEVVKIADDFQMGTIMWTVDTIDWKRPEPDVLLQRVMRKIHPGAIVLMHPT 265 Bacillus anth...
P50850         205 EQLDKTNEQIEQTIGVKPKWFAPPSGSFRKAVIDIAAEKQMGTVMWTVDTIDWQKPAPSVLQTRVLSKIHNGAMILMHPT 284 Bacillus subt...
BAB06125       205 EEIVQTNEVIKATIEVTPKWFAPPSGSYNDLVVQRAAEHGMRTIMWSVDTIDWRNPDPNEMVDRVLSKVHPGAMILMHPT 284 Bacillus halo...
BAC13561       285 ASSTRGLEEMITIIKEKGYKIGTIEALLS 313 Oceanobacillus iheyensis HTE831
tigr:GBAA_3943 266 SSTTEALDTMITKLKEQGYKVGNITELLD 294 Bacillus anthracis str. 'Ames Ancestor'
P50850         285 DPTAESLEALITQIKDKGYALGTVTELMD 313 Bacillus subtilis subsp. subtilis str. 168
BAB06125       285 ESSAAGLENLIRGIQDRGLHIGTVSDLMD 313 Bacillus halodurans C-125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap