Conserved Protein Domain Family
spore_BofA

?
TIGR02862: spore_BofA 
pro-sigmaK processing inhibitor BofA
Members of this protein family are found only in endospore-forming bacteria, such as Bacillus subtilis and Clostridium tetani. Among such bacteria, it appears only Symbiobacterium thermophilum lacks a member of this family. The protein, designated BofA, is an integral membrane protein that regulates the proteolytic activation of the RNA polymerase sigma factor K. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 163046
View PSSM: TIGR02862
Aligned: 9 rows
Threshold Bit Score: 50.3603
Threshold Setting Gi: 77996966
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgilanl:BCZK0023  4 TIIIVGILALVFIFLVFGVSSKPLRFIGKALFHVTLGVALLFIVNVVGTYFDFHIPINLGTATITSLLGLPGVAALVVIK 83  Bacillus cer...
P24282            4 IFIIGIILGLVILLFLSGSAAKPLKWIGITAVKFVAGALLLVCVNMFGGSLGIHVPINLVTTAISGILGIPGIAALVVIK 83  Bacillus sub...
BAD74306          4 KVVITVLLALIAVLLIVGARLKALRLIGYAAIRLIVGALALFVINAIGGHFNIHIPINLVTSIVCGFLGLPGAAALIVID 83  Geobacillus ...
BAD62584          4 WLILSILGGIVVLLLIIGAPVKPLRVAGQIGVRLIIATLLLFLLNSFATATGLFIPINAITATTVALLGLPGMLLLVAVQ 83  Bacillus cla...
BAC11989          4 TVFISIIVGLIIILLLVGAPVKPMKYIGQATIKLGIGMLFLFFINVFGGAIGLHIPINIFTVFVSGFLGVFGIGSLAAIH 83  Oceanobacill...
BAB79755          9 DDIILLIIGVLVAILILRLIFGSIGKIIGLVINSVFGAILLMIVNYFGAYFGITIGINLLTALIAGILGIPGVVLMILFQ 88  Clostridium ...
tigr:CHY_2672     2 ELLGLV--------------------LKKIFFWLVIGFILLGVFNLIGDKIGWHLPINPVTVVIAGVLDLPGIILLTALK 61  Carboxydothe...
AAM24252          3 EGTLSFIIAVLILVFILWVLGKSLRLLLKFALNSLVGFIMLLFFNFFGALFNVELPVNIVTSFITGVFGIAGIAILLILK 82  Caldanaeroba...
WP_003359493      4 EYIAYFILAIFLLFVVVKIFSWPLKILLSLIGNAILGTVLLFILNVIGGAFNFYIGINIWTALIAGFFGIPGVIFLIIFK 83  Clostridium ...
jgilanl:BCZK0023 84 LYI 86  Bacillus cereus E33L
P24282           84 QFI 86  Bacillus subtilis subsp. subtilis str. 168
BAD74306         84 RYI 86  Geobacillus kaustophilus HTA426
BAD62584         84 QLI 86  Bacillus clausii KSM-K16
BAC11989         84 LFV 86  Oceanobacillus iheyensis HTE831
BAB79755         89 VFV 91  Clostridium perfringens str. 13
tigr:CHY_2672    62 YLV 64  Carboxydothermus hydrogenoformans Z-2901
AAM24252         83 YMF 85  Caldanaerobacter subterraneus subsp. tengcongensis MB4
WP_003359493     84 LFL 86  Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap