Conserved Protein Domain Family
spore_sigH

?
TIGR02859: spore_sigH 
RNA polymerase sigma-H factor
Members of this protein family are RNA polymerase sigma-H factor for sporulation in endospore-forming bacteria. This protein is also called Sigma-30 and SigH. Although rather close homologs in Listeria score well against this model, Listeria does not form spores and the role of the related sigma factor in that genus is in doubt. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131906
View PSSM: TIGR02859
Aligned: 6 rows
Threshold Bit Score: 351.409
Threshold Setting Gi: 18146088
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAS39029       13 FRDLEDEAIVELVRKGNTDALEYLIHKYKNFVRAKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCI 92  Bacillus cereu...
AAM25452       18 YEQMEEEEIVSRAQQGDELALEYLIERYKNFVKAKARTYFLVGADKEDIIQEGMIGLYKAIRDYKNNKLTSFKAFAELCV 97  Caldanaerobact...
tigr:CHY_2333  15 YDYMSDEEIVEWARAGDEQALEYIINKYKNFVRSKARAYFLIGADREDIIQEGMIGLYKAVRDFRPDKLSSFRAFAELCV 94  Carboxydotherm...
BAC12059       14 LEQLDDTDLLQFIRQGNSHALDLLIQRYISFVRAKARTYFLVGADKEDIIQEGMIGLYKAIRDYDVDKLSSFKAFAELCV 93  Oceanobacillus...
AAO37068       21 FKNMLDEEVVLEAKEGNTRAQEYLINKYKNFVKAKAKSYFLIGADREDIYQEGMIGLYKAIRDFRADRLASFKAFAELCI 100 Clostridium te...
BAB82128       16 FKDLTDKEVVMLAKNGDNMAQEYVISKYEQFVKAKSKSYFLIGADKEDIYQEGMIGLYKAIRDFNPDKFASFKSFAELCV 95  Clostridium pe...
AAS39029       93 TRQIITAIKTATRQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELLSDLERKVLS 172 Bacillus cereu...
AAM25452       98 TRQIITAIKTATRQKHIPLNSYVSLNKPIFDEESDRTLMDVVSTQCIADPEELIISKEEYVNIENKMEELLSGLEWEVLV 177 Caldanaerobact...
tigr:CHY_2333  95 TRQIITAIKTATRQKHIPLNSYVSLNKPIYDEDSDRTLMDVLSGVKVADPEELIISREEFADIEGKMNEILSSLEWKVLI 174 Carboxydotherm...
BAC12059       94 TRQIITAIKTATRQKHIPLNSYVSLDKPIYDEESDRTLLDIIGGSIDVDPQELLISQEDYGTLEHKLSKLLSDLEKKVLQ 173 Oceanobacillus...
AAO37068      101 TRQIITAIKTATRQKHIPLNTYISLNKPIYDDESDRTLMDVLSEAKVSDPEELVISREEIGCIQNEMEEVLSALEMEVLM 180 Clostridium te...
BAB82128       96 TRQIITAIKTATRQKHIPLNTYISLSKPIYEEESDRTLLDTVVGITITDPESLVIGKEEVEKIESAINSVLSELELEVLN 175 Clostridium pe...
AAS39029      173 LYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYME 210 Bacillus cereus ATCC 10987
AAM25452      178 AYLDGKSYQEIAEDLNRHVKSIDNALQRVKRKLERYLE 215 Caldanaerobacter subterraneus subsp. tengcongensis MB4
tigr:CHY_2333 175 YYLEGKSYQEIACELNRHVKSIDNALQRVKRKLEKYLE 212 Carboxydothermus hydrogenoformans Z-2901
BAC12059      174 LYLDGRTYQEISEHLNRHVKSIDNALQRVKRKLEQLME 211 Oceanobacillus iheyensis HTE831
AAO37068      181 SYIDGKSYQEIACDLDRHAKSIDNALQRVKRKLEKFLN 218 Clostridium tetani E88
BAB82128      176 SYLDGKSYQEIACDLDREAKSIDNALQRVKRKLEKCLN 213 Clostridium perfringens str. 13
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap