Conserved Protein Domain Family
spore_yqfC

?
TIGR02856: spore_yqfC 
sporulation protein YqfC
This small protein, designated YqfC in Bacillus subtilis, is both restricted to and universal in sporulating species of the Firmcutes, such as Bacillus subtilis and Clostridium perfringens. It is part of the sigma(E)-controlled regulon, and its mutation leads to a sporulation defect. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131903
View PSSM: TIGR02856
Aligned: 10 rows
Threshold Bit Score: 100.065
Threshold Setting Gi: 77997309
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK79261        9 FRRFLARKLDFPSDAVMYTPRIniSVTGDEEITIENYRGIVEFSDENIKVNTEVGTISIDGKNFEIVFISGSTIILGGKF 88  Clostridium ac...
AAS43289       32 MKNWLTKQIDLPVDVLMDLPRI--TLVGQVHIYIENHRGLLVFSDKEVRLLLKHGQLLIKGQSFVIKTILPEELLLEGII 109 Bacillus cereu...
BAD76780       10 MKRWMAEKLELPADIMMDLPRI--TMVGHIHIYIENHRGLLAFSDKELRLLLRNGQLVVRGEQFVIKTILPEEILLEGKI 87  Geobacillus ka...
P54468          8 MKAWLTRALEIPPDVMMDLPRI--TMVGRLHIYIENHRGLLLFSENEVRLMLKQGQCIISGKNFVIKAILPEEILLEGTI 85  Bacillus subti...
BAC13913        8 IRSLLIEQFSLPSDVILEMPRI--TIIGHIHFYIENHQGLEVYSNNELKLKVTNGYVQIKGDAFVLKMMLPKEIMLEGTI 85  Oceanobacillus...
AAM24223        5 LKDELINAIDFPKDALLNLPKI--TLIGKNHLTVENHRGIVEYLPERVRINSTVGIIRVIGENMVINSIMTEVITITGEI 82  Caldanaerobact...
BAD39512        8 LGERLVSLLELPGDAVLDVPRA--VLIGSMELVVENHRGLVEYRPERVVLRMPEGKMTVDGADLRIGFLSPDQAVILGRI 85  Symbiobacteriu...
BAB81727        8 VTNRIAEELDLPKEIINGEPKI--VVHGKSEIIIENHKGIEVFKENEIKINSNLGVIIIEGTNLEIRFIGTETIALTGRL 85  Clostridium pe...
tigr:CHY_0423   2 PKKWTIS----PGEIFADLPRV--VFLGNEMVIVEGHKGIQSYSPEIIKIIRFNEKITIEGKNLEIFLITSEELQITGQV 75  Carboxydotherm...
WP_003357863    8 AKETVANKLDLPRDIILNHPKI--IVTGNEEISIENHRGVVVFEEKVVKINSGSGLISIYGKDFEILFMGGSTITLGGKF 85  Clostridium bo...
AAK79261       89 KTIAYGG 95  Clostridium acetobutylicum ATCC 824
AAS43289      110 EQVTFLE 116 Bacillus cereus ATCC 10987
BAD76780       88 SQVVYID 94  Geobacillus kaustophilus HTA426
P54468         86 DVVRYVE 92  Bacillus subtilis subsp. subtilis str. 168
BAC13913       86 HEVKFLP 92  Oceanobacillus iheyensis HTE831
AAM24223       83 KSVEIVV 89  Caldanaerobacter subterraneus subsp. tengcongensis MB4
BAD39512       86 DGLRYAP 92  Symbiobacterium thermophilum IAM 14863
BAB81727       86 KNLSFEE 92  Clostridium perfringens str. 13
tigr:CHY_0423  76 ERVHFER 82  Carboxydothermus hydrogenoformans Z-2901
WP_003357863   86 KSIEYEG 92  Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap