Conserved Protein Domain Family
spore_II_GA

?
TIGR02854: spore_II_GA 
sigma-E processing peptidase SpoIIGA
Members of this protein family are the stage II sporulation protein SpoIIGA. This protein acts as an activating protease for Sigma-E, one of several specialized sigma factors of the sporulation process in Bacillus subtilis and related endospore-forming bacteria. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131901
View PSSM: TIGR02854
Aligned: 10 rows
Threshold Bit Score: 204.512
Threshold Setting Gi: 51856047
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC13430        1 MTIYLDAVWMLNFLIDLMLLMLVKLLARDSVNLLRLLFGALIASLIVPITIF-----------------YPESFINGAVG 63  Oceanobacillus...
AAT61297        4 LVVYADVVWLLNACIDFLLLLLTATVLKKKIKRWRLVLGAFIGSTIVIFAFT-----------------PFASMMTHPIM 66  Bacillus thuri...
BAB06276        1 MTLYADVIWLLNLCIDYLLIALTAILLKRPFQQFRFICASFVASLIVVFMFT-----------------PVADFFLQPIV 63  Bacillus halod...
BAD64887        1 MTVYLDLIWLLNAGIDYLLLAATALLLKRRFSQWRLVLAALFASLIVFLMFT-----------------PAAPLFLNPVI 63  Bacillus claus...
AAM24840       12 KLMYLDILFLENLLINYVILSLTQRFSRKYSTPFKLLLGAFIGAGYVLIFFL-----------------TPYSFFREFLA 74  Caldanaerobact...
Q45832          1 MVIYLDVLIFENSIVNTFLLYITAQTLRIKVKMRYLILAGIFGGLYVIVLVI-----------------PTLKIFSSLIF 63  Clostridium ac...
AAO35701        1 MHIYLDILFLENFIINRFLLSLTAKTVKEKVNSIFLSLASIIGSSYLLFILI-----------------GKKTYANNIFF 63  Clostridium te...
BAB81469        1 MTVYIDIVILENFLINFFLLYLTLQTLKDTIIYKRIILAAFLGAIYTLFVFV-----------------PGLNILTSLPL 63  Clostridium pe...
tigr:CHY_2057   2 PVYFLESVFLGNFILSYAALIFAAKVLNLKLSFAKNLFFSLVGAVMAEIYLA---------------------WPYFGIK 60  Carboxydotherm...
BAD40205        5 PAVRPDVFFLVNFGLDLALLWFAARAARVRYRAWRLWVAALLGAALAVLPVLlpdvpaaapaspsagpaPKAGWLFSGAA 84  Symbiobacteriu...
BAC13430       64 KLLYSVLIIFSAFGWKGTYQTLKLCLLFYFVSFAIGGGLTAIHFMLSSPVsMTANGMItfnkgfGDPISWLFILIGFPII 143 Oceanobacillus...
AAT61297       67 KLLYSLLIVYTAFGFTTFRNYTQTVFTFYFVTFMVGGGLMGTHFFLQTNE-MVNGLVQsqsisyGDPISWLFVIFGFPVI 145 Bacillus thuri...
BAB06276       64 KGLYSALIVWIAFGYQRWRFFLQALFMFYFVTFMTGGGLFALHYFWQTEIpFLTDHSLtsg-sfGSGISWLFVCLGFPLV 142 Bacillus halod...
BAD64887       64 KLIYSGLIVFIAFGYKRFSFFLQNLASFYFVTFVTGGGLFAMHYFFETNVdVLAFLPGhg--vgGSMVSWAFVLIGFPLA 141 Bacillus claus...
AAM24840       75 KFLLSLLIIYMAFSPETLKEFFRILSVFYLVSFAMGGTIFALLYAVKGREtALPVG------------------IGFAAL 136 Caldanaerobact...
Q45832         64 KIIAAFLMIIICFRKKSLRFNIKALAVLIMYSMVTAG--LCFFIELNNTRgSYFNAFI-------GNVSYKWILIAIMII 134 Clostridium ac...
AAO35701       64 KLLVAFCMVFTIFRKKNIIFKLKTTFIFILYSILLAG--ICIFMQIANGNgLKSNVAI-------VNFPYKKLLMAIILL 134 Clostridium te...
BAB81469       64 KLLFSFGMITIISERRELKTIIKRYITFLVITFAFCG--TCFMFALVENQyNISESFI------INDYSTKSIIFSLIIS 135 Clostridium pe...
tigr:CHY_2057  61 ILAFCVFFLSTYLLTKSPSSAGKLFLLTLASFFFLNGAYHALIF---------------------TGYYPEFFLLAALIL 119 Carboxydotherm...
BAD40205       85 LLAGSAALAWLLVWPGPWAQFAAVLGFFWTGLILSGG----LLFLLAERYpALFAAPPaalvagGAGVA----LAGAQLL 156 Symbiobacteriu...
BAC13430      144 WYFTKRRMDEHVGEQIKYDQMCEVFLTLNQKVQQSKGYIDSGNQLVDPLTKRPVIICDRTFLKEWFTEDEWLQLEKAKNN 223 Oceanobacillus...
AAT61297      146 YYFSKKRIESVEVTKIHYDQIVKLKIQLAEEELELAGLIDSGNQLYDPLTKTPVMIMHISSLEHCLPAWLTEQIYSKTEI 225 Bacillus thuri...
BAB06276      143 WYFSKQRLETIEVKKVQYERLVDVEVWLEQSKLTIRGIIDSGNQLQDPFTKAPVMIIQADVLRGQIPDEWIEQMLNVESI 222 Bacillus halod...
BAD64887      142 LYFCKQQFGAVKSKQFHASQLAEVEFWIEGISFSAPGLIDTGNRLRDPLTKMPVMVAEAALLYSAFGKQQVDALLELEAE 221 Bacillus claus...
AAM24840      137 LLFLN--WDYVVKKAKQDKMKYEIYIEIFGKKVKTYGFVDTGNKLFDPLSNLPVVVVAYSSVKSLLPYDLEEFVAEGKID 214 Caldanaerobact...
Q45832        135 YMFVNRIIWFINDRKLTQSLIYEIEICFKDNSKFINAFLDTGNELREPITNLPVIVVEKDMVSGIKWDDCPKF------- 207 Clostridium ac...
AAO35701      135 YLLLERIVSFIRDRIVLDKLIYKIDIDLKNSKKSINAFLDTGNELVEPVTNLPVIVVEKDIFQKNEIEDYDTV------- 207 Clostridium te...
BAB81469      136 YILVSGVMNYFKNRAIINNFIYDLDVCIDSEVVNIKAFLDTGNGLVEPATALPVIIAEREKFRWVNIKEKDQF------- 208 Clostridium pe...
tigr:CHY_2057 120 AFIGEYAYKQYQRIVRLKKYGFSLEIVYSGKKVTVQSFLDTGNRLYDPQLGWPVVVVEYRAVKKILPVDFFQS------- 192 Carboxydotherm...
BAD40205      157 W-------QAYRERAEVDDGLYELEVRVDGRREVVEGLVDSGNLLRTPVGRMPVAVVEGGRLRSLLPPAVLEAASSGPMG 229 Symbiobacteriu...
BAC13430      224 LDmd---eiPKRWQDKIQIIPYQGVDGGSSMMIGIRPERVIV--NYNDQQLLATNVIIGIQFGNLVRDDSYHCLLHPQIM 298 Oceanobacillus...
AAT61297      226 PQip---enDSGWATKLRLIPFRAVGVENQFLWAIKPESVQI--YHEGSSIVVNKVLIGLNTQQLSTNGEYQCIVHPKML 300 Bacillus thuri...
BAB06276      223 GTtd----gDERFMRRMSVIPYRVVGQPQRLLAVFKPDSVRI--RHEEEWMTVSKVLIGLNDKALSPEDTYQCIVHPKMI 296 Bacillus halod...
BAD64887      222 NE-------PSPLMKRVRLIPYRAVGQGSSYMAALKPDRVKI--RYQNEAYETNHVLIGLSRETLSPEQHYRCIVHPQIM 292 Bacillus claus...
AAM24840      215 FGkvleiikDEKWHSRIGIIPFSGVG-TKGLLLGIRPDRLII------NGKEIKDVMLGISTDKME-----FALLNPEIM 282 Caldanaerobact...
Q45832        208 ------------------YVPFRLFNGKAGNLEAFKPSYVKI---YIGDKVEVRNAIIALIDNKLSSLNDYNALLSRGSI 266 Clostridium ac...
AAO35701      208 ------------------YIPFSVVNGDRGMLKAIKPEMVSI---YKKREIEKKEVLIAFSDKKLSSSGDYRALLSRGII 266 Clostridium te...
BAB81469      209 ------------------RIPYKVVDGNSGYMKGIKIDNIKL--CNVNGETMTRDAILCFCDNKLSKEGEYEALLSRGII 268 Clostridium pe...
tigr:CHY_2057 193 --------------KTIRRIPFRGVGRGQGFFWGFIPDELKI--WQEGEVIRVKRAVVAITFQSLNSE--FQALLSEEIL 254 Carboxydotherm...
BAD40205      230 LDg-----lPAEWQSRCQLVPFAAVGRSDGWLLVIRPDGLSVrpRGRGDWVQVEGR-VGLAAGPLDPEGRYAALLPTAMI 303 Symbiobacteriu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap