Conserved Protein Domain Family
spore_dpaA

?
TIGR02853: spore_dpaA 
dipicolinic acid synthetase, A subunit
This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by TIGR02852. This protein is also known as SpoVFA. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131900
View PSSM: TIGR02853
Aligned: 6 rows
Threshold Bit Score: 446.462
Threshold Setting Gi: 51856372
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC13564         2 NRLIAVIGGDARYLELIKQLKNVpNNKLLLCGFDkLEQGFTGLNELELDELDPSTLDVVILPITGTDQHGKVETVFTDKE 81  Oceanobacillu...
BAD40530         5 GKIIAVIGGDRRMAEAVHFLLRA-GARVRIAGLE-WEDRFAGVEVCTSGADALTGAQVVILPVQGVSPDGTVYTEGDVPP 82  Symbiobacteri...
tigr:CHY_1152    7 GINLTILGGDLRNVYLIDELEKL-GAFIKVLGLP--VARRSKVVLCHSLEEALKDTDVVVLPMPGVNHQGKLFAPLCEES 83  Carboxydother...
novoz:BL01213    4 GLTIAIIGGDARQLEIIRKLTEQ-DAKVFLIGFDqLDHGFTGATKLKLNELDFGTIDSIILPVSGTSMEGTVATVFSNEK 82  Bacillus lich...
tigr:GBAA_3939   4 EMHIAVIGGDARQLEVIRKLVEL-DAKLSLIGFDqLDHGFTGAAKESIQNLDFTSLDAIILPVAGTNAKGEVDTIFSNEK 82  Bacillus anth...
BAD64753         4 GTHVVMIGGDARQLEIIRKLSAL-DAKISLVGFEqLNDGFIGASKQELPDIEWSTVDAILLPVGGMSNDGLIASVFSNQQ 82  Bacillus clau...
BAC13564        82 ISLGPDWFQQLKKSCVVFTGITNDYLTEQTKNAGVTLISLLERDDVAIYNSIPTAEGAIMMAFEQTDQTIHSSRVMVVGF 161 Oceanobacillu...
BAD40530        83 CVIDLDGLRRVARGAPVFVGLSNPHLNRLCEEAGLPLIEYREADHFATWNSIPSAEGAIQMAMESTPFTIFGSRSLVLGF 162 Symbiobacteri...
tigr:CHY_1152   84 YYLTPELKDSIKGEVLFVVGFANSYLKQLAADLGVELVEIAEMDHVAIYNSIPSAEGAIQMAMEMIPITIHGSNAFVIGF 163 Carboxydother...
novoz:BL01213   83 VVLKQEHLEKTKPHCAIYSGISNQYLDGMAKGANRRLIKLFERDDIAIYNSIPTVEGAIMMAIQHTDFTIHGSNVMVLGL 162 Bacillus lich...
tigr:GBAA_3939  83 VSITKEQIENTPEHFTIYSGIGTPYLENLVSTTNRKLIKLFDRDDVAIYNSIPTVEGTLMMVIQHTDYTIHGSNVMVLGF 162 Bacillus anth...
BAD64753        83 LKLKAAYLNETPDHCTIYTGISTDRLEKLAAKAKCKIVLLMDRDDVAIYNSIPTAEGAVMLAIQHTDHTIHHAKVAVLGL 162 Bacillus clau...
BAC13564       162 GRVGNTVANKFSALGAKVSVCARSIRDLARITEMGLHAIPLNKMSEYTAECDILINTIPALVVTKESIQHLPTNAVIIDL 241 Oceanobacillu...
BAD40530       163 GRTGRAIAMLLRGLMSDVSVAARSELDQARIWAAGHRPVEWPKLADAVAEADIIFNTVPALVLTRDILSRAPRHAVIIDV 242 Symbiobacteri...
tigr:CHY_1152  164 GRTGQTLARMLAGIGARVFVAARKPKDLARIYEQCYIPVTFKELEVKIVEADIVFNTVPALVLPANLLQKLKKDAVIIDL 243 Carboxydother...
novoz:BL01213  163 GRTGMSISRTFSALGARVKVGARDSAHLARIMEMGLTPFHTNELAEHVENIDICINTIPSLILDKHVLSRMTPRTLILDL 242 Bacillus lich...
tigr:GBAA_3939 163 GRTGMSVARAFQSLGAHVKVGARRSEHIARITEMMFSPFHMQNIEKEVGNIDIVINTIPHLVVTANVISKMPAHTLVIDL 242 Bacillus anth...
BAD64753       163 GRIGMTIARTFHALGASVFVGAKETALLARAFELGVEPFPLTALKETLKNIDLVINTIPARIVTSDVLAELPQHAFVLDL 242 Bacillus clau...
BAC13564       242 ASKPGGTDFTYAKRRGINAILARSLPGIVAPRTAGKILAdvvnQILDE 289 Oceanobacillus iheyensis HTE831
BAD40530       243 ASAPGGTDFEAARELGLTARLAPGLPGIVAPVTAGRIIA----ELVVR 286 Symbiobacterium thermophilum IAM 14863
tigr:CHY_1152  244 ASNPGGVDFEAAKSLGIQAVLAPGLPGKVAPKTAGKLLAkvlpELILK 291 Carboxydothermus hydrogenoformans Z-2901
novoz:BL01213  243 ATRPGGTDFDFAEKQGIKALLAPGLPGIVAPKTAGQIIAnvlcNLLSE 290 Bacillus licheniformis DSM 13 = ATCC 14580
tigr:GBAA_3939 243 ASKPGGTDFRYAEKRGVKALLAPGLPGIVAPKTAGQILAnvlsQLLAE 290 Bacillus anthracis str. 'Ames Ancestor'
BAD64753       243 ASKPGGVDFAYAKKRGLKAMLVPGLPGMVAPKTAGKILAnvlsDLLHE 290 Bacillus clausii KSM-K16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap