Conserved Protein Domain Family
spore_V_T

?
TIGR02851: spore_V_T 
stage V sporulation protein T
Members of this protein family are the stage V sporulation protein T (SpoVT), a protein of the sporulation/germination program in Bacillus subtilis and related species. The amino-terminal 50 amino acids are nearly perfectly conserved across all endospore-forming bacteria. SpoVT is a DNA-binding transcriptional regulator related to AbrB (See pfam04014). [Regulatory functions, DNA interactions, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131898
View PSSM: TIGR02851
Aligned: 6 rows
Threshold Bit Score: 284.352
Threshold Setting Gi: 28202399
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CHY_0202   2 KATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRNGEVILKKYSPIGELGDFAKEYAESLHESLGHIAFIADRDT 81  Carboxydotherm...
BAB82188        2 KATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDRDGGVILKKYSPIGELTDFSKEYAEALQQSTGHIILISDNDA 81  Clostridium pe...
AAO34845        2 KATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDREGGVILKKYSPIGELSEFSKGYAESLQQTIGNIVIICDRDM 81  Clostridium te...
AAT58903        2 KATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAKEYAEALYDSLGHNVLVCDRDS 81  Bacillus thuri...
BAC12020        2 KATGIVRRIDDLGRVVVPKEIRRTLRIREGDPLEIFVDREGEVILKKYSPINELGHFAKEYAEALFQSLQTPVMITDRDD 81  Oceanobacillus...
AAM25687        7 KATGIVRRIDDLGRVVIPKEIRRTLRIKEGDPLEIFTDKEGEIILKKYSPISELSDFAQEYADSIYQSTKHAVCITDTDT 86  Caldanaerobact...
tigr:CHY_0202  82 IIAVAGAPKKEFLNKPIGPAVERAMNERKTVLITATGEheYCKECITAEEgKclFTSEIIAPIIAEGDPIGAVIIASREp 161 Carboxydotherm...
BAB82188       82 FISVSGTSKKEFLERKISDELEDIMDKRKSVVLSATNK--NLIPIHSDDD-EskYSGQVIAPILAEGDAIGSVVILSKE- 157 Clostridium pe...
AAO34845       82 LISVSGVQKKEYMDKKISFELEKIIEERKTILISKE-R--EIIPLYDDEEfEekYATQVISPIIAEGDAIGAVIIVSKDk 158 Clostridium te...
AAT58903       82 IIAVSGVSKKEYLNKSVGDLIEKTMEERKSVIMTDESD----VSIIDGVTeK--VHSYTVGPIVANGDPIGAVIIFSKEa 155 Bacillus thuri...
BAC12020       82 VIAVAGESKKEYLNKPISNAIADTIEGRSQVFEVDTKS----MEIIDGQEqQ--LQSYCIHPVIANGDPIGCVLIFSKEe 155 Oceanobacillus...
AAM25687       87 VIAVAGVPKKELIDKPISQELENYLEEKKTVILGTGKDk-GPIKIAEGQEfS--ITSQVIVPIISRGDTIGSVVIFTKEp 163 Caldanaerobact...
tigr:CHY_0202 162 GVKFGTLEQKMAETAAHFLAKQME 185 Carboxydothermus hydrogenoformans Z-2901
BAB82188      158 GKALGEVEQKLAETAAAFLGKQME 181 Clostridium perfringens str. 13
AAO34845      159 DEEFGEVEMKLAETASSFLGKQME 182 Clostridium tetani E88
AAT58903      156 --IISEIEHKAVNTAASFLAKQME 177 Bacillus thuringiensis serovar konkukian str. 97-27
BAC12020      156 --KLSKIEQKAAETASTFLAKQME 177 Oceanobacillus iheyensis HTE831
AAM25687      164 GETVTEVEAKIAETAAAFLGKQME 187 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap