Conserved Protein Domain Family
spore_sigG

?
TIGR02850: spore_sigG 
RNA polymerase sigma-G factor
Members of this family comprise the Firmicutes lineage endospore formation-specific sigma factor SigG. It is also desginated stage III sporulation protein G (SpoIIIG). This protein is rather closely related to sigma-F (SpoIIAC), another sporulation sigma factor. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131897
View PSSM: TIGR02850
Aligned: 7 rows
Threshold Bit Score: 482.022
Threshold Setting Gi: 1350864
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB06273           4 NKVEICGVDTSKLPVLKNQEMRELFARLQ-SGDTSARETLVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNF 82  Bacillus ha...
jgilanl:BCZK3662  34 NKVEICGVDTAKLPVLKNDEMRKLFREMQ-SGEISAREKLVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNF 112 Bacillus ce...
BAC13432           4 HKVEICGVDTSKLPVLKNEEMKKLFVRMQeDGDITAREELVNGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKSIDNF 83  Oceanobacil...
tigr:CHY_2055      4 NKVEICGVNTSKLPVLTNQEMKKLFLKVK-EGDMEARQKLISGNLRLVLSIIQRFTNRGEYVDDLFQVGCIGLIKAIDNF 82  Carboxydoth...
BAD40207           3 NKVEIPGVNTAKLPVLTNAQMRELFVRMR-SGEKAARDELITGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLMKAIDNF 81  Symbiobacte...
P33658             4 NKVEICGVNTSKLPVLKEKEMRELLISMR-NGNTTAREKFIKGNLRLVLSVIQRFNNRGENADDLFQVGCIGLIKSIDNF 82  Clostridium...
AAM24838          11 NKVEISGVNTSKLPVLKPSKQRELLIRMK-NGDKKAREEFINSNLRLVLSVIQRFNNRGESVDDLFQVGCIGLIKAIDNF 89  Caldanaerob...
BAB06273          83 DLSQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVRDQLMGEKQreKEPTVQEIAKELGVPKEDVVFAL 162 Bacillus ha...
jgilanl:BCZK3662 113 DLGQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVREKLIAENS--KEPTAMDIAKVLEVTHEEIVFAL 190 Bacillus ce...
BAC13432          84 DLSHNVRFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVREKLISKTS--KEPSPAEIAKEMDIPQTDVVFAL 161 Oceanobacil...
tigr:CHY_2055     83 DLEQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDVAYKALQVRDNLVGRFS--REPTVSEIAQELKVPQEEVVFAL 160 Carboxydoth...
BAD40207          82 DLGQNVKFSTYAVPMIIGEIRRYLRDNNPIRVSRSLRDIAYKALQVRDALVNRLS--REPTVQEIADELGLPLEEIVYAL 159 Symbiobacte...
P33658            83 DLSQNVKFSTYAVPMIIGEIRRYLRDNNSIRVSRSLRDIAYRALQVRDRLISKNN--KEPTVSQIAKELKIPREEVIFAL 160 Clostridium...
AAM24838          90 DLDQNVKFSTYAVPMIIGEIRRYLRDNTPIRVSRSLRDIAYKALQVRDKLVSENS--KEPTVGEIAKELDLPSEEVVMAL 167 Caldanaerob...
BAB06273         163 DAIQDPVSLFEPIYNDGGDPIYVMDQISDDRNKDVQWVDEIALKEAMVRLNDREKLILNMRFYQGKTQMEVAEEIGISQA 242 Bacillus ha...
jgilanl:BCZK3662 191 DAIQDPVSLFEPIYNDGGDPIFVMDQLSDEKQKDEQWVEELALKEGMKRLNDREKMIIRKRFFQGKTQMEVAEEIGISQA 270 Bacillus ce...
BAC13432         162 DAIQDPVSLFEPIYNDGGDPIFVMDQISDEKDKDSSWVDKLSLKEGMHQLNEREKMILNKRFFQGKTQMEVADEIGISQA 241 Oceanobacil...
tigr:CHY_2055    161 DAIQDPVSLFEPIYQDGGDPIFVMDQIKDEKNTDHNWLQGIALKEALERLNERERLILKLRFYEGKTQMEVAEEIGISQA 240 Carboxydoth...
BAD40207         160 DSIQEPVSLFEPLYNDGGDPIYVMDQVSDESQQDSQWLEGISIRQALHRLNERERLILTLRFFEGKTQMEVAEEIGISQA 239 Symbiobacte...
P33658           161 DAIQDPISLFEPIYHDDGDAIYVMDQISDNKNLDDSWLQNISIKEAMKKLSDREKMILNMRFFDGRTQMEVADEIGISQA 240 Clostridium...
AAM24838         168 DAIQEPVSLFEPIYHDGGDAIYVMDQVSDDKNVDEVWLEKIALKEALEKLNEREKMILTMRFFEGKTQMEVAKEIGISQA 247 Caldanaerob...
BAB06273         243 QVSRLEKAAIQQMSKHA 259 Bacillus halodurans C-125
jgilanl:BCZK3662 271 QVSRLEKSAIKQMNKTI 287 Bacillus cereus E33L
BAC13432         242 QVSRLEKAAISQMNKQM 258 Oceanobacillus iheyensis HTE831
tigr:CHY_2055    241 QVSRLEKAALNHLRKFV 257 Carboxydothermus hydrogenoformans Z-2901
BAD40207         240 QVSRLEKAALSHMRKYV 256 Symbiobacterium thermophilum IAM 14863
P33658           241 QVSRLEKTALKHMKKYV 257 Clostridium acetobutylicum ATCC 824
AAM24838         248 QVSRLEKAALNHMRKYI 264 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap