Conserved Protein Domain Family
spore_III_AD

?
TIGR02849: spore_III_AD 
stage III sporulation protein AD
Members of this family are the uncharacterized protein SpoIIIAD, part of the spoIIIA operon that acts at sporulation stage III as part of a cascade of events leading to endospore formation. Note that the start sites of members of this family as annotated tend to be variable; quite a few members have apparent homologous protein-coding regions continuing upstream of the first available start codon. The length of the alignment and the scoring cutoff thresholds for the model have been set to try to detect all valid members of the family, even if annotation of the start site begins too far downstream. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131896
View PSSM: TIGR02849
Aligned: 7 rows
Threshold Bit Score: 100.052
Threshold Setting Gi: 20516288
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P49781         29 FAFLIVVFAGCAIFLYLVDQIYDIIRMIEKIAINANVNMVYVETILKIIGIAYIAEFGAQLTKDAGQGAIASKIELAGKI 108 Bacillus subti...
BAC13847       27 LAFFLILITGIIIFFSVIQQIQLIFETIRTLGNQANIQTLYLNTILKIIGISYIAEIGSHLTKDAGLDSVSKYIELAGKI 106 Oceanobacillus...
tigr:CHY_2004  27 IAVLLSLTAGVVVFLLLMDKIAAVVEVFTGLGERAGLNSLYLGIIFKIIGISYLAEFGAQICRDAGEGAIAQKIELAAKI 106 Carboxydotherm...
BAD40844       27 LAMQLSIAAGVMLFALMMAKVLRVVEVIQSLAARASLEQAHIDTVLKIIGIAYITDFGAQVLSDAGEKAVATKVEMAGKI 106 Symbiobacteriu...
AAM24510       27 IAVILSLVTGIIIFVSILPKLSSVVEVLNSLARKSGLDTIYFVTTLKIIGIAYITEFGSQLCQDANEKNLASKIEIAGKV 106 Caldanaerobact...
AAK80049       27 IAVSVSMIAGILIFIFMIPRITAVMQILQQFALKAKVDFVYLTTVLKILGIAYIASFCSEICKDAGQNSIASRVEFSGKI 106 Clostridium ac...
BAB81536       28 FAVFLLLGAGIVIFLFVMPYVNEIIAFMQDIARESGMDSSYIAIVMKIIAIAYLSTFCSYICNDAGVTLLGKKVEFTGKI 107 Clostridium pe...
P49781        109 LILVMAVPILTVIIETILGLI 129 Bacillus subtilis subsp. subtilis str. 168
BAC13847      107 FILLLAVPIITTVIEAIVGFL 127 Oceanobacillus iheyensis HTE831
tigr:CHY_2004 107 LVIILAIPILMAVLETLLKLL 127 Carboxydothermus hydrogenoformans Z-2901
BAD40844      107 IIMLLAVPIILGVLDAILNLL 127 Symbiobacterium thermophilum IAM 14863
AAM24510      107 MIIFLSIPIIIGLVEAILSIM 127 Caldanaerobacter subterraneus subsp. tengcongensis MB4
AAK80049      107 LILMLAVPILMGVLNAILNII 127 Clostridium acetobutylicum ATCC 824
BAB81536      108 MILLLAIPIMANILNSILSIM 128 Clostridium perfringens str. 13
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap