Conserved Protein Domain Family
spore_sigmaK

?
TIGR02846: spore_sigmaK 
RNA polymerase sigma-K factor
The sporulation-specific transcription factor sigma-K (also called sigma-27) is expressed in the mother cell compartment of endospore-forming bacteria such as Bacillus subtilis. Like its close homolog sigma-E (sigma-29) (see TIGR02835), also specific to the mother cell compartment, it must be activated by a proteolytic cleavage. Note that in Bacillus subtilis (and apparently also Clostridium tetani), but not in other endospore forming species such as Bacillus anthracis, the sigK gene is generated by a non-germline (mother cell only) chromosomal rearrangement that recombines coding regions for the N-terminal and C-terminal regions of sigma-K. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131893
View PSSM: TIGR02846
Aligned: 8 rows
Threshold Bit Score: 392.93
Threshold Setting Gi: 18145431
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB81474        3 MLQYLLE-LVGSKIFLTGYVTGNsTFPKPLNEKEEKIYLERLKDGDVEAKRVLVERNLRLVAHIVKKYSSnyqNSKEMDD 81  Clostridium pe...
BAD76820        3 GIFTAFTfLLKELTFLVSYIKNN-AFPQPLSAQEEEKYLALMAKGDEQARNRLIEHNLRLVAHIVKKFEN---TGEEVED 78  Geobacillus ka...
BAC13955        3 GILSVLGlIIKEALFFVSYVKNH-SFPQPLPPDKESKYLQLMQEGDEVARNKLIEHNLRLVAHIVKKFEN---TGEDMED 78  Oceanobacillus...
AAB94775        3 VMYCLFN-IVGSITFFVAYIGNGaSFPQPLSESEEKYYLKKLKEGDPLAKNILIERNLRLVAHIVKKYSY---SGKEVDD 78  Clostridium ac...
AAM24483        4 VIAALVGtIVKEILNL-GYLTNTnSFPSPLSPEEERKYLEAYRRGDEEARNILIERNLRLVAHVVKKYSG---TGRDLDD 79  Caldanaerobact...
tigr:CHY_0617   3 VLGALITlVVEGLLFLLGYLAGS-AFPQPLSEEEEAYYIDRLLQGDREARDVLAERNLRLVAHIVKKFEG---TGEATED 78  Carboxydotherm...
BAD40943        4 MLGPLAEaIVRSMLLLAGFVANSgTFPQPLSEEEEAKYLSRLQNGDEEARAVLIERNLRLVAHIVKKFDN---TGEDVDD 80  Symbiobacteriu...
WP_012047887    3 FLSYLWD-VLGSALFLTGYVTGNtSFPKPLSDEEEKYYLDRLKKGDALAKDILVERNLRLVAHIVKKYSY---PGKDIDD 78  Clostridium bo...
BAB81474       82 LISIGTIGLIKAIDSFDTNKGIRLATYAAKCIDNEILMFFRNTKKTKGEVFLQDPIGVDKEGNEICLIDILSSDSDSVLE 161 Clostridium pe...
BAD76820       79 LISIGTIGLIKAIESYSPGKGTKLATYAARCIENEILMHLRSLKKTRKDVSLHEPIGQDKEGNEISLLDILKAEGEDIAD 158 Geobacillus ka...
BAC13955       79 LISIGTIGLIKGVESFSTDKGTKLATYAARCIENEILMHLRALKKVKKDVSLHDPIGQDKEGNEISLIDILEAENENVIE 158 Oceanobacillus...
AAB94775       79 LISIGTIGLIKAIDSYNVSKGTRLATYAARCIENEILMLIRNNKKSKNEVYLQDPIGVDKEGNEISLIDILSSDDDSVIE 158 Clostridium ac...
AAM24483       80 LISIGTIGLIKAIDTYDFEKGTHLATYAAKCIENEILMSIRAEKKMKGEVFLQDPIGVDKEGNEISLMDVLGTDEDEVSE 159 Caldanaerobact...
tigr:CHY_0617  79 LISIGTIGLIKAIDTFRPDKGTKLATYAAKCVENEILMHLRATKKNRGEVSLYDPIGFDKEGNEITLLDILGTRGDIVLE 158 Carboxydotherm...
BAD40943       81 LISIGTVGLIKAIGTFKPERGTRLATYAARCIENEILMHLRSLKRVRGEVSLYDPIGVDREGNEITLIDVLGSDPDVVPD 160 Symbiobacteriu...
WP_012047887   79 LISIGTVGLIKAIDSFDNSKGTRLATYAARCIENEILMLIRNNKKTKGEVYLQDPIGVDKEGNEISLMDILSSDEDSIIE 158 Clostridium bo...
BAB81474      162 AVENSLQVKELYKKMsDVLSPREKEIIQMRYGLLDGDIKTQREIAGILGISRSYVSRIEKKALKKLNKEFK 232 Clostridium perfringens...
BAD76820      159 EIHLNMELEQVKQYI-SVLDEREKEVIINRFGLGRQREKTQREIAKELGISRSYVSRIEKRALMKMFHEFY 228 Geobacillus kaustophilu...
BAC13955      159 YIQLNMEISKMQKYF-SVLDKREREVIVYRYGLNDREEMTQREIAKKLNISRSYVSRIEKRALMKVFHEYY 228 Oceanobacillus iheyensi...
AAB94775      159 IVENRIQIGKLYVEInRVLKGREKAIIKMRYGLGDGKPRNQREIAQILGISRSYVSRIEKRALKKLYRQLN 229 Clostridium acetobutylicum
AAM24483      160 QVEKKIQIKKLYSKLnSVLKNRERMIIEMRYGLYNGRVRTQREIAKMLGISRSYVSRIEKKALNKLYKELS 230 Caldanaerobacter subter...
tigr:CHY_0617 159 QVVRMLDAETIEKNL-KKLTPRERKVIEERFGLSQTPRKTQREIAKKMGISRSYVSRIEKRAILKLLNCFP 228 Carboxydothermus hydrog...
BAD40943      161 LVGKRLDESKLREKL-KKLGGKERQVLELRYGIAGGPRKTQREIARMLGISRSYVSRIEKKAVMKLCRELF 230 Symbiobacterium thermop...
WP_012047887  159 IVSTKIEVKKLYGKIdTCLRGREKKVIQMRYGLKDGRPRTQREIAGILNISRSYVSRIEKKALKKLYKELN 229 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap