2L0K


Conserved Protein Domain Family
spore_III_D

?
TIGR02844: spore_III_D 
Click on image for an interactive view with Cn3D
sporulation transcriptional regulator SpoIIID
Members of this protein are the transcriptional regulator SpoIIID, or stage III sporulation protein D. It is present in genomes if and only if the species is capable of endospore formation as occurs in the model species Bacillus subtilis. SpoIIID is a DNA binding protein that, in B. subtilis, downregulates many genes but also turns on ten genes. [Regulatory functions, DNA interactions, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131891
View PSSM: TIGR02844
Aligned: 6 rows
Threshold Bit Score: 129.229
Threshold Setting Gi: 20515150
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2L0K_A    2 HDYIKERTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEILDYHKSIRHLRGGEATKLKYKK 81  Bacillus subtilis su...
AAK80802  2 KDYIEERVMEVAKYIIESKATIRKTAKVFGVSKSTIHKDMTERLPQINPQIAELAKGVLELNKAERHIRGGKATKMKYKA 81  Clostridium acetobut...
AAM23471  2 KDYIEERTLEISKYIVEHKATVREAAKVFGVSKSTVHKDVTERLPEINFELYKEVREVLSKNKAERHIRGGKATKMKYQK 81  Caldanaerobacter sub...
BAD39088  2 KDHIWKRVLEIGNHICRTKDTVRETASVFGVSKSTVHKDVTERLPRINPELAAKVKRVLDQNKAERHIRGGAATRQKYLE 81  Symbiobacterium ther...
P15281    2 HDYIKERTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEILDYHKSIRHLRGGEATKLKYKK 81  Bacillus subtilis su...
BAB81887  2 KDYIEERVLEVAQYIIYSRATIRKTAKVFGVSKSTIHKDMTERLPKINPDIAEEAKSILDLNKAERHIRGGKATKLKYKV 81  Clostridium perfring...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap