1FFT


Conserved Protein Domain Family
CyoB

?
TIGR02843: CyoB 
Click on image for an interactive view with Cn3D
cytochrome o ubiquinol oxidase, subunit I
Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131890
View PSSM: TIGR02843
Aligned: 14 rows
Threshold Bit Score: 1034.24
Threshold Setting Gi: 49239296
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FFT_A                2 FGKLS------LDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLWKEWLTSVDHKRLGIMYIIVAIVMLLRGFAD 75  Escheric...
AAG04707              2 FGKLT------LSAVPYHEPIVMVTLAVVALLGLGVVGAITYYRKWTYLWTEWLTSVDHKKIGVMYIVVALVMLVRGFAD 75  Pseudomo...
AAY93965              2 FGKLT------WDAVPTGEPIIMYTLLVVGLIGLGVLGAVTYQRKWGYLWREWLTTVDHKKIGVMYILVALVMLLRGFSD 75  Pseudomo...
AAL53081              2 FGKLT------LEAIPYHEPIIMVTLAAVAGGALAILAAITYYRKWVPLWNDWLTSVDHKRIGVMYIVLALVMLFRGFSD 75  Brucella...
jgi:ReutB_4578        2 FGKLT------LAAIPTHEPIIMGTLVAVLLLGGALVGAITYYRKWSYLWTEWICSVDHKRIGVMYIIMALIMLLRGFAD 75  Ralstoni...
jgi:Bcep18194_A5375   2 FGKLT------LSAIPFDQPIIMGAGAFMGLIVLGILAALTITGRWKWLWTQWLTTVDHKKLGVMYIIVALIMLLRGFAD 75  Burkhold...
AAL41165             12 FGKLT------WESIPLHEPILVATFAAVALGGIVVVGALTYFRLWGYLWNEWFTSIDHKKIGIMYIILALVMLLRGFAD 85  Agrobact...
CAG69199              4 LGKLG------WDSIP-KEPIVLVTMVLMAIGAIAVLGGITYFKKWGYLWKEWFITVDHKKIGIMYILVSVVMLLRGFAD 76  Acinetob...
lhbprmlnih:CBU_1039   7 FGKLT------LDAIPLHTPIIMGAGVFMAVILVAVLVAITITKKWSYIWHEWITSVDHKKIGIMYVLLAGVMLLRGFSD 80  Coxiella...
CAF25622              2 FGRLTdptagaFHALA-HEPIVLYTCIAIFVGGLIAVIALTVLGWWGALWRNWITTVDHKRIGIMYIVLGIIMLVRGFAD 80  Bartonel...
1FFT_A               76 AIMMRSQQALASA-GEAGFLPPHHYDQIFTAHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVI 154 Escheric...
AAG04707             76 AIMMRGQLALAEG-ANHGYLPPEHYDQIFTAHGVIMIIFMAMPFMTGLMNLAVPLQIGARDVAFPFLNSLSFWLLVVSAM 154 Pseudomo...
AAY93965             76 AIMMRTQQAMAAS-GGPGYLPPEHYDQIFTAHGVIMIFFMAMPFVAGLMNLVVPLQIGARDVAYPFLNALSFWLFVAGAA 154 Pseudomo...
AAL53081             76 AVMMRAQQALASG-ANEGFLPPHHYDQIFTAHGVIMIFFVAMPFIVGLMNFVVPLQIGARDVAFPYLNSLSFWLTVAGAI 154 Brucella...
jgi:ReutB_4578       76 AIMMRTQQAIAVG-EAAGYLPPHHYDQIFTAHGVIMIFFVATPFILGLMNVIVPLQIGARDVAFPFVNSLSFWMSAVGAV 154 Ralstoni...
jgi:Bcep18194_A5375  76 AIMMRMQLALSYN-G-PGYLPPHHYDQVFTAHGVIMIFFMAMVFMVGLMNLIVPLQIGARDVAFPFINSLSFWMTAVSAI 153 Burkhold...
AAL41165             86 AIMMRVQQAIASG-GSEGYLPPHHYDQIFTAHGVIMIFFMAMPMITGLMNFVVPLQIGARDVSFPFLNNFSFWMTTAGAI 164 Agrobact...
CAG69199             77 AIMMRLQLFLAKG-GGEGYLHPDHYDQIFTAHGVIMIFFVAMGLVVGMMNISVPLQIGARDVAFPLLNSLSFWLFAGAAG 155 Acinetob...
lhbprmlnih:CBU_1039  81 VILMRSQQAIAAG-ANMGYLPAQHYDQIFTAHGVIMIFFVAMPLVFGLANIALPLQIGARDVAYPYLNSFSFWMTFVGAM 159 Coxiella...
CAF25622             81 AIMMRTHQALALGsETAGYLPPEHFDQIFSAHGVIMIFFMATPILFGLFNYLIPLQIGARDVAFPFANNLGFWITVAAAI 160 Bartonel...
1FFT_A              155 LVNVSLGVGEFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWASLC 234 Escheric...
AAG04707            155 LVNVSLGLGEFARTGWVAYPPLSELAYSPGVGVDYYIWALQISGMGTLLTGINFLVTVFKMRTPGMKLMQMPIFTWTCTF 234 Pseudomo...
AAY93965            155 LVNISLGVGEFARTGWVAYPPLSELGYSPGVGVDYYIWALQISGIGTLLTGVNFFVTILKMRTTGMTLFKMPVFTWNSLC 234 Pseudomo...
AAL53081            155 LVNISLGVGEFAKTGWLAYPPLSGKAFSPDVGMDYYLWALNISGMGTLLSAVNLITTIIKMRAPGMGMMQLPVFTWTALC 234 Brucella...
jgi:ReutB_4578      155 LVMMSMFVGDFAATGWVAYPPLSGLGYSPTVGVDYYIWSLQISGLGTTLTGINFIATILRMRAPGMNLMKMPVFTWTALI 234 Ralstoni...
jgi:Bcep18194_A5375 154 LINVSLVIGEFAQTGWLAYPPLSELQFSPGVGVDYYLWALQISGVGTLLTGVNFFVTIIKMRAPGMTLMKMPVFTWTALC 233 Burkhold...
AAL41165            165 ITMISLFVGEYAQTGWLAYPPLSGIDGSPGVGVDYYIWGLQIAGVGTTLSGINLIVTIIKMRAPGMTMMRMPIFVWTSLC 244 Agrobact...
CAG69199            156 LMMASLVLGEFAATGWMAYPPLSGIQYSPGVGVDYYIWALQVSGLGTLLSGVNFFVTIIKMRAPGMKLMDMPIFTWTSLC 235 Acinetob...
lhbprmlnih:CBU_1039 160 LCNVSLVIGDFAATGWLAYPPLSELYYSPTVGVDYFIWALQIAGVGSLLGGINFIATVVKMRCPGMTFMRMPIFVWTTFC 239 Coxiella...
CAF25622            161 LINVSLGIGNFGRGGWLMYPPFSELQNSPDTGVDYYLWSLQLSGIATTMGAINFVATIIKMRAPGMTMMRMPVFCWSAFV 240 Bartonel...
1FFT_A              235 ANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILILPVFGVFSEIAATFSRKRLFGYT 314 Escheric...
AAG04707            235 ANILIVASFPILTAALGLLSLDRYLDMHFFTNELGGNAMMYINLFWAWGHPEVYILILPAFGIFSEVTATFAGKRMFGYK 314 Pseudomo...
AAY93965            235 TAVLILAAFPILTATLLMLSLDRYLGMHFFTNEAGGNPMMYVNLIWAWGHPEVYILILPAFGVFSEIAATFSSKRLFGYV 314 Pseudomo...
AAL53081            235 SNVLIVAAFPILTVTLSLLTLDRYLDFHFFTNDAGGNPMMYVNLIWIWGHPEVYILVLPCFGIYSEIIATFSGKRLFGYT 314 Brucella...
jgi:ReutB_4578      235 TNILIVAIFPVLTATLALLTADRYLDMHFFTNELGGNAMMYVNLIWIWGHPEVYVLILPCFGAFSEIIATFSRKPLFGYK 314 Ralstoni...
jgi:Bcep18194_A5375 234 TNVLIMASFPILTATLALLGLDRYLGMHFFTNEAGGNAMLYLNLIWAWGHPEVYILILPAFGIFSEVISTFAKKPLFGYK 313 Burkhold...
AAL41165            245 SNILIVASFPILTATLALLTLDRYAGTNFFTNDLGGNPMMYVNLIWIWGHPEVYILVLPAFGIFSEIVATFSGKRLFGYA 324 Agrobact...
CAG69199            236 TAVLIIASFPVLTATLAMLTLDRYFGFHFFTNELGGSPMLYVNLIWTWGHPEVYILVLPAFGLYSEIVATFSRKALFGYK 315 Acinetob...
lhbprmlnih:CBU_1039 240 SMILIALAFPILTVSLALLTLDRLLGMHFFTQYAGGNMMMYINLIWAWGHPEVYILILPAFGVFSEVVATFSQKKLFGYV 319 Coxiella...
CAF25622            241 SNVLILVIYPVLAVAFALLACDRYLGMNFFTNAAGGNPMVWINYVWIFGHPEVYVLVVPAFGIVSEVVSTFSSKRLFGYT 320 Bartonel...
1FFT_A              315 SLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVG 394 Escheric...
AAG04707            315 SMVWASAAITFLGFTVWLHHFFTMGSGGDVNGFFGVATMLISIPTGVKLFNWLFTIYKGRLRFSTPILWTLGFMVTFTIG 394 Pseudomo...
AAY93965            315 SLVWATIAITILSFIVWLHHFFTMGAGGNVNAFFGIMTMIIAVPTGVKIFTWLFTMYRGRVRFATPMLWTMGFIVTFSIG 394 Pseudomo...
AAL53081            315 SMVYATVAITVLSFLVWAHHFFTMGGGASVNSFFGVATMIISIPTGAKVFNWLFTMYKGRVRMETPVMWTIGFMCTFVIG 394 Brucella...
jgi:ReutB_4578      315 SMVYATSSIGVLSFFVWLHHFFTMGSGANVNAFFGIMTSIISIPTGVKLFNWLFTMYRGRIRFHSSTLWTIGFMVTFAIG 394 Ralstoni...
jgi:Bcep18194_A5375 314 TMVYATCAIMVLSFLVWLHHFFTMGSGANVNAFFGIMTMIIAIPTGVKVFNWLFTMYRGRIEFTTPVLWTIGFMVTFTLG 393 Burkhold...
AAL41165            325 SMVYATAVITILSYLVWLHHFFTMGSGANVNAFFGITTMIISIPTGAKIFNWLFTMYKGRIKFDVPMLWTIGFMITFVIG 404 Agrobact...
CAG69199            316 SMVYATIAITVLAFVVWLHHFFTMGAGANVNAFFGIMTMIIAIPTGVKIFSWLFTMYKGRISFETPMLWTLGFLVTFGIG 395 Acinetob...
lhbprmlnih:CBU_1039 320 TMVYATFAITFLSFIVWLHHFFTMGSGGDVNAFFGIATMIIAVPTGVKIFNWLFTMYKGKIIMRTPMLWVFAFFITFTIG 399 Coxiella...
CAF25622            321 SMVWAMLVILILSLLVWGHHFFTMGGGEAVNTFFGIATMIIAVPTGVKVFNWLLTMYKGRIRFEPPMLWCIGMIFTFVGG 400 Bartonel...
1FFT_A              395 GMTGVLLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYAL 474 Escheric...
AAG04707            395 GMTGVLLAIPGADFLLHNSLFLIAHFHNTIIGGAVFGYLAGFAFWFPKAFGFTLDEKWGKRSFWCWLVGFYMAFMPLYIL 474 Pseudomo...
AAY93965            395 GMTGVLLAVPGADFMLHNSLFLIAHFHNVIIGGAVFGYMAGLTYWFPKAFGFTLNDRLGRLSFWCWLVGFYFAFMPSYVL 474 Pseudomo...
AAL53081            395 GMTGVLLAVPPADFVLHNSVFLIAHFHNVIISGVLFGCFAGVVYWWPKAFGFKLNERLGKNAFWCWLVGFMLAFMPLYVL 474 Brucella...
jgi:ReutB_4578      395 GMTGVLLAVPGADFVLHNSLFLVAHFHNVIIGGVVFGCLAAMSFWFPKVFGFRLNEFWGKVSFWCWLIGFCLAFLPLYGL 474 Ralstoni...
jgi:Bcep18194_A5375 394 GMTGVMMAIPGADFVLHNSLFLIAHFHNVIIGGVLFGYLAGFNYWFPKAFGFKLNEKLGKAAFWFWQIGFYVAFVPLYVL 473 Burkhold...
AAL41165            405 GMTGVLLAVPPADFVLHNSLFLIAHFHNTIIGGVVFGVLAGIVYWFPKAFGYRLDPFWGKLSFWFWFIGFYFAFMPLYIL 484 Agrobact...
CAG69199            396 GLTGVLMAVPPADFLVHNSLFLIAHFHNVIIGGVVFGMFAGIIFYWPKMFGWKLNEAWGKAAFWFWFFGFYFAFMPLYIL 475 Acinetob...
lhbprmlnih:CBU_1039 400 GVTGVLMAIPPIDFQVHNSLFLVAHFHNVIIGGVLFGFFAGLIYWFPKAFGFQLDERLGQWSFLFWVAGFYMAFMPLYLL 479 Coxiella...
CAF25622            401 GLTGVLMSIVPADWQFHNSLFLVAHFHHTIIGGVIFAYLAGLAFWFPKVFGYKPNRALGIASFWCWFIGFYLAFFPVYAL 480 Bartonel...
1FFT_A              475 GFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCL----VIQMYVSIRDRDq--nRDLTGDPWG-GRTLEWATSSPP 547 Escheric...
AAG04707            475 GFMGMTRRLNHYDNPLWKPYLVVAFFGAVLIFCGIACQ----LIQLFVSVRNRKq--lADVNGDPWE-GRTLEWATSSPP 547 Pseudomo...
AAY93965            475 GFMGMTRRLNHFDNPEWRPWLMLELIGVGIILCGVTCQ----LLQLWVSVRDRRa--nRDRSGDPWD-GRTLEWATTSPP 547 Pseudomo...
AAL53081            475 GLMGMTRRLNHTENPAWHIYLIIAAIGVAVILCGIVCQ----ILQIMVSIRDRDk--lRDTNGDTWGsGRTLEWSISSPP 548 Brucella...
jgi:ReutB_4578      475 GMKGMTRRMNHYVNPEWQPWLIVAMIGALIIGAGILAL----LWQIYVSVRDREq--nRDLTGDPWN-ARSLEWSTPSPA 547 Ralstoni...
jgi:Bcep18194_A5375 474 GFMGMTRRINHYDNPAWHPWLLVAAFGAVLIAIGIACQ----LLQLVVSIRNRNlpeyRDTTGDPWG-GRTLEWATSSPP 548 Burkhold...
AAL41165            485 GLMGITRRISQFEDNSLQIWFVIAAFGAFLIALGIASF----IIQLIVSFLKRDq--lRDVTGDPYN-ARTLEWSTSSPP 557 Agrobact...
CAG69199            476 GFMGMTRRLNTYDNPEWDPYLAIALFGAVLVAIGIACF----LMQIIVGFLQRHq--nMDHTGDPWD-SRTLEWSTSSPA 548 Acinetob...
lhbprmlnih:CBU_1039 480 GLMGVMRRLNHYADVTLQPYFIVAAIGAALIMIGILLQ----IAQIIVSIKNRDk--lRDKTGDIWN-GRTFEWSVASPA 552 Coxiella...
CAF25622            481 GLMGATRRLQHYMEPSWQPMFMIAALGAFIILLGILCFglqiVLAIWYGIKHKGr--lPVTLNDSWGdARTLEWSTSSPP 558 Bartonel...
1FFT_A              548 PFYNFAVVPHVHERDAFWEMKEK----G--E-AYKKPDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAG 620 Escheric...
AAG04707            548 PFYNFAELPKVQDVDAFHDMKKA----G--T-AYRKLPAYQPIHMPKNTAAGFSIAVFAFVFGFAAIWHIWWLMAVGFVG 620 Pseudomo...
AAY93965            548 PLYNFAEQPVVDDLDAYWGMKER----G--T-STLNRTDYRAIHMPRNTSAGLVMSAFALVCSFALVWHIWWLALASLAA 620 Pseudomo...
AAL53081            549 PFYNFAETPTVRDHDAWWDMKQN----G----YVRRTEKFARIHMPKNTATGFLVGILSIPFGFAMIWHIWWLAIASALA 620 Brucella...
jgi:ReutB_4578      548 PHYNFAIVPNITSLEQHWDDKEA----G--R-AWQAPARYEDIHMPRPTAAGFIVSMFGLVLCFGFVWHIWWLAGAGLAG 620 Ralstoni...
jgi:Bcep18194_A5375 549 ADYNFAVIPQVRTLDAYADMKAR----G--E-GRPNPAAIRDIHMPSNTCAGLVVAIFSLVLGFALVWHIWWMAIGGLVG 621 Burkhold...
AAL41165            558 PQYNFAFTPVIHDVDAWHDMKKR----G----YSRPLDGFIPIHMPKNTGAGVIISAISVVLGFALVWHIWWLAALSFIG 629 Agrobact...
CAG69199            549 PFYNFAHVPNGNGVDAFWVDKEN----G--I-AYARNTKYEDIHMPTDRAAGFVIAMFITTMGFALIWHIWWLVAVCFIA 621 Acinetob...
lhbprmlnih:CBU_1039 553 PFYNFAFIPKVEERDQYWEDKKKakmeGrpLrVNPEHIQYKDIHMPRNTSAGFVIAMFAGVFGFAVVWHMWIPAIIGIVG 632 Coxiella...
CAF25622            559 PSYNFAMIPKIQSDDAYWNMKKN----G--Y-QRPT-SGFSKIHMPSNTSAGIIAGFFSLAVGFALVWHIWWLVAIGLIG 630 Bartonel...
1FFT_A              621 MIITWIVKSF-DEDVDYYVPVAEIEKLE 647 Escherichia coli K-12
AAG04707            621 MIGSFIVRSY-NQDVDYYVQPEEIEKIE 647 Pseudomonas aeruginosa PAO1
AAY93965            621 TMVALVVRSN-DEDTDYFIPADEVARIE 647 Pseudomonas protegens Pf-5
AAL53081            621 MFVVAIAHSF-NNDRDYYVSADEVQRVE 647 Brucella melitensis bv. 1 str. 16M
jgi:ReutB_4578      621 MIATFIARSY-DRDVDYYVPAEEVERTE 647 Ralstonia eutropha JMP134
jgi:Bcep18194_A5375 622 IVATLVIYSS-RDNDGYYIPASTVRKIE 648 Burkholderia lata
AAL41165            630 VIAVSIAHTF-NYNRDYYIPASDVSTVE 656 Agrobacterium tumefaciens str. C58
CAG69199            622 SIVSLIRSSF-TKEVDYYVPAAEVERIE 648 Acinetobacter sp. ADP1
lhbprmlnih:CBU_1039 633 VIATVIARTF-SKDIDYYVKAETVKQIE 659 Coxiella burnetii RSA 493
CAF25622            631 FIATIVCHSLmGDHHGYYIPAEEVQKTE 658 Bartonella quintana str. Toulouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap