1FFT


Conserved Protein Domain Family
CyoC

?
TIGR02842: CyoC 
Click on image for an interactive view with Cn3D
cytochrome o ubiquinol oxidase, subunit III
Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131889
View PSSM: TIGR02842
Aligned: 17 rows
Threshold Bit Score: 216.739
Threshold Setting Gi: 46395811
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FFT_C               25 KIFGFWIYLMSDCILFSILFATYAVLVNGTAGG-PTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLA 103 Shigella...
CAG44916             21 NVFGFWIYIMSDCVLFATLFATFAVFHKHTFGG-PGAQELFSLPYVFVETMLLLISSFTFGLAMLNRNSENINHVIKFLW 99  Francise...
lhbprmlnih:CBU_1038  18 DVFGFWLYIMTDCILFASLFATFLVLHHPGAVG-PPLKPLIDLPYVLVETFFLLASNFTFCLAIFGINKNKLPAVIFWLI 96  Coxiella...
CAE31806             32 TLLGFWVYLMSDCLVFACLFATYGVVGRNYDGG-PTGAELFDLPLVAVNTSLLLLSSITYGFAMLEMRRQRIGATQAWLA 110 Bordetel...
CAF23915             32 TYFGFWMYLMTDCLLFATLFCTYAVLHKSTFGG-PSSHELFQLPTAFIETLILLLSSMTCGLSMLAAVKSQKKYVIGWLI 110 Candidat...
BAC24295             25 KILGFWVYLMSDCILFATLFATYFVLKDNVANG-PSGKEIFEIPLVFLETIILLSSSMTCSIASFSIKKNNKIKTNIWLF 103 Wigglesw...
CAD83314             16 TIFGFWLYIMSDCILFASLFAMHAVLSTNFQKDlLISNNIFKLTFVFTETILLLLSSITCSTSMIYANITNPKKTLQWMI 95  Candidat...
MBL:BPEN250          16 TIFGFWLYIMSDCILFASLFAIYSVLCNNTADC-SSGKDIFSLPFVFIETCCLLLSSLTHCKVMIYVEKSCTKQINIWMG 94  Candidat...
Q89AA5               15 ELLGFWLYLMSDCIIFCTLFSVYFILVDNVAQG-PSGHNIFQNNLIIIETFLLLFSSFSCNLVLFEMKNKNLYMVFLWLG 93  Buchnera...
WP_011520452         24 KILGFWIYLMSDCILFAMLFATYVVLSHSIAGG-PSGKEIFELPAVQFETFCLLLSSLTYGIAILAMYRKQNNSVILWLF 102 Candidat...
1FFT_C              104 LTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLF 183 Shigella...
CAG44916            100 ITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSFFTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLSLF 179 Francise...
lhbprmlnih:CBU_1038  97 LTFILGAGFVVMEVMEFIHLNAEGYSWHVSGAASAFFTLVGTHGFHVTMGLLWILIMIIQLPILKINKNTARRMVYLGLF 176 Coxiella...
CAE31806            111 VTGLLGAGFLGLELYEFAHLIHQGAGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTLMVQVSRHGLIPENRRRLMCLSMF 190 Bordetel...
CAF23915            111 ITFCLGSSFLFLEIQEFSLLIREGNGFDRSAFLSSFFTLVGTHGLHITFGLLWMIVMIAQVIYQGITLSTFRRLALFSLF 190 Candidat...
BAC24295            104 ITVILGIIFINIEISEFYSLICKNYGPDRSAFLSIFFTIVGTHGVHVISGIIWMIVIMIQIYFYGCDKINKIRLKLLSLF 183 Wigglesw...
CAD83314             96 LTLLLGLGFISMEIYEFHHLIANKYNPSRNAFFSSFFVLIGTHGIHVITGLIWIIIMTIHLIMTGLTQQNLIRLHCFSLF 175 Candidat...
MBL:BPEN250          95 ITFLLGLCFISMEIYEFYHLIKLGNNPCRSAFLSSFFTLVGTHGLHVMAGLIWIAVMIIHIVYQGLTYTNYIRMQCLSLF 174 Candidat...
Q89AA5               94 ITFLLGLLFVFLELFEFFHLINLGFGPTRSGFLSSFFVLIATHGIHVISGLIWIIVMIKYVYTFNITNLIYYRMLCLNLF 173 Buchnera...
WP_011520452        103 CTFILGLGFIIVEIMEFYNLIINGFGPNRSAFLSGFFSLVATHGCHVISGLIWIMVMIVHVYKKGLTLDNQIRLQCLSLF 182 Candidat...
1FFT_C              184 WHFLDVVWICVFTVVYLMGAM 204 Shigella flexneri
CAG44916            180 WHFLDIVWIFVFSIVYLLGAV 200 Francisella tularensis subsp. tularensis SCHU S4
lhbprmlnih:CBU_1038 177 WNFLDIVWIFLFTIVYLMGAV 197 Coxiella burnetii RSA 493
CAE31806            191 WHFLDLIWVGVFTFVYLMGVL 211 Bordetella bronchiseptica RB50
CAF23915            191 WHFLDLIWISIFTFVYLLGVA 211 Candidatus Protochlamydia amoebophila UWE25
BAC24295            184 WYFLEIIWIFVFNVIYLLGII 204 Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
CAD83314            176 WHFLDIIWICVFTEVYLIGVL 196 Candidatus Blochmannia floridanus
MBL:BPEN250         175 WHFLDVIWICVFTEVYLLGVL 195 Candidatus Blochmannia pennsylvanicus str. BPEN
Q89AA5              174 WHFLDIVWVFIFSFVYLFGMV 194 Buchnera aphidicola str. Bp (Baizongia pistaciae)
WP_011520452        183 WHFLDIIWICVFTVVYLLGVL 203 Candidatus Baumannia cicadellinicola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap