Conserved Protein Domain Family
spore_YyaC

?
TIGR02841: spore_YyaC 
putative sporulation protein YyaC
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, also called YyaC, is a member of that panel and is otherwise uncharacterized. The second round of PSI-BLAST shows many similarities to the germination protease GPR, which is found in exactly the same set of organisms and has a known role in the sporulation/germination process. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131888
View PSSM: TIGR02841
Aligned: 10 rows
Threshold Bit Score: 248.767
Threshold Setting Gi: 51858148
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAT62675  43 IPIILVCIGTDRSTGDALGPLVGTKLEQVGIKNFQVFGTLDEPVHALNLEEKIQNIQKDNPASFIIAVDACLGKSQSIGS 122 Bacillus thuringien...
P37521    43 KPIVVVCIGTDRSTGDSLGPLVGMKLKQMQLTRFHVYGTLSDPVHAVNMKDKINDIHKLHKNPFVIAVDACLGRVKSVGS 122 Bacillus subtilis s...
BAB07773  41 RELVIVCIGTDRSTGDALGPIVGTALTKECLNCFHVYGTLADPVHAVNLEEKLKLIEKKHRRPFIIAIDACLGKLSSVGK 120 Bacillus halodurans...
AAM25888  32 REIILLCIGTDRSTGDSLGPLTGHKLKPLLRNKAHVFGTLEDPLHAKNIIDVLKEIRNTFYMPFTIAIDASLGSLKHVGH 111 Caldanaerobacter su...
AAK81647  33 RDIVFLCIGTDRSTGDSLGPMVGYKLTKFHKNNLIVFGTLQEPVHAKNLCNTMDIIKTKYENPFIIAIDACLGSTKTVGN 112 Clostridium acetobu...
AAO34757  34 KHIILLCIGSDRSTGDSLGPLVGHNLKFLSRNNFHVFGNLEMPVHAKNLHQILKYINKKFDDPYIIAVDACLGHIQNIGK 113 Clostridium tetani E88
BAB82355  34 RPIVFICIGSDRSTGDALGPLIGEKIKFLSKNNIFIYGTLEETVHAGNLKETVKIIKSKHKKPFIIAIDACLGAVDNVGH 113 Clostridium perfrin...
BAD66641  42 RDLLLICIGTDRSTGDSLGPLVGNLLEGQNLNQFHVHGTLAEPIHAANMEKRLASIYKKHPNAFVVALDACLGKTANVGY 121 Bacillus clausii KS...
BAC15440  40 REYVAVFIGTDRSTGDALGPLAGMYFQSYKPRHIRVYGTIHEPVHAVNLEESLERIDKLHNNPFIIAIDACLGRSTSIGH 119 Oceanobacillus ihey...
BAD42306  26 DGLVALCIGTDRSIGDALGPLVGSRLAVALPEGVTVLGTLDKPVHAGNLTEALAWVARNFRRPLVLAVDACLGRAESVGF 105 Symbiobacterium the...
AAT62675 123 ITTGMGPSKPGAAMNKKLPAVGDLHIHGIVNLNGFMEFFVLQNTRLSLVMKMADVIAQSI 182 Bacillus thuringiensis serovar konkukia...
P37521   123 FQIGDGPLKPGAGVQKDLPEVGDLHINGIVNVSGFMEYFVLQNTRLNLVMNMANVLAEGL 182 Bacillus subtilis subsp. subtilis str. 168
BAB07773 121 VSLAAGPVQPGAAVNKKLPAVGDVHLTGIVNIGGMMEYFVLQNTRLHTVMQLADTISSSL 180 Bacillus halodurans C-125
AAM25888 112 ISIGKGPIKPGAGVSKELPPVGDMFVTGIVNISGFMEYMVLQNTRLRTVMKMADIIAAGV 171 Caldanaerobacter subterraneus subsp. te...
AAK81647 113 IVIQNTPLSPGSAMNKSLPTVGDLSITGIVNVSGPFDFMVLQSTRLYSVLKLADIISRGI 172 Clostridium acetobutylicum ATCC 824
AAO34757 114 VFVEDKPLKPGSAVNKDLPPVGNLSITGIVNISGTLEFMVLQNTRLFTVMQLAELISNGI 173 Clostridium tetani E88
BAB82355 114 VLIEKRPLKPGIALNKDLPEVGDLSILGIVNISGSLEFMVLQNTRLYTVMLLANAISNGI 173 Clostridium perfringens str. 13
BAD66641 122 ITLSAEPLKPGAAMGKNLPEIGDICLTGIVNVGGLMDFYMLQSTRLHVVMSMAQKISKAV 181 Bacillus clausii KSM-K16
BAC15440 120 IITEKKSLQPGTALNKTLPAVGDVSITGVVNVSGFMEHSILQNTRLSVVMDMAKQVSSIL 179 Oceanobacillus iheyensis HTE831
BAD42306 106 LAVGSGSLRPGAGVSKSLPPAGDVYLTGVVNVGGFMEYFVLQNTRLSLVMRMAQVAAAGL 165 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap