Conserved Protein Domain Family
spore_V_AE

?
TIGR02839: spore_V_AE 
stage V sporulation protein AE
This model describes stage V sporulation protein AE, a paralog of stage V sporulation protein AC. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAE have a stage V sproulation defect. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131886
View PSSM: TIGR02839
Aligned: 9 rows
Threshold Bit Score: 131.326
Threshold Setting Gi: 77997119
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CHY_1955   3 FLLSFLVGGVICVIGQLMMDLTsfRVTPAHVLVSFVTAGALISGFGVYEKLVELAGTGATLPLTGFGHLLTQGAIEGFKQ 82  Carboxydotherm...
BAB05260        3 YIIAFTVGGLICIVGQVLLDVA--KMTPTQVLSTLVVAGAVLDGFHLYDRLIDFAGAGATIPITSFGHSLVHGAMAEGER 80  Bacillus halod...
BAD64333        3 FLWAFLVGGAICLIGQVLLDAA--KLTPVQMLVVMAIVGIVLDGFHLYEHLVELAGAGATVPLTGFGYSLVHGAMEEGAK 80  Bacillus claus...
AAP10985        3 FIYAFLVGGVICLIGQLLLDFV--KLTPAHLMATFVVIGAILDGFGLYDKLIKFAGAGATVPITSFGHSLLHGAMHAAEK 80  Bacillus cereu...
BAD64362        3 FLWAFLVGGVICVIGQLLMDVG--KLTPAHTMSTLVVSGAILSGFGLYEPLIDFAGAGVTVPITSFGNSLVQGALMEANR 80  Bacillus claus...
AAK80259        4 YIASFLVGGAMCVIVQILMDKF--SITPAMILVSLVTLGVILGALDIYDILVKYGKAGATVPLPGFGYSLAKSTIAEVDK 81  Clostridium ac...
AAO36725        5 YIMAFLVGGAICVVAQIIINKT--KFTPARILVTFVTVGVILGALNIYDVVVKVGKAGATVPLPGFGFNLAKSTIKEVDQ 82  Clostridium te...
AAM24545        3 YIRAFLMGGLICAIAQILIDKT--KLTPARILVTYVTLGAILGGIGVYKKLIDIGGAGATIPLLGFGNSLAQGVIKAVEK 80  Caldanaerobact...
BAA12660        3 YLLAFVCGGAICIVGQLLLDIF--KLTPAHVMTSFVVIGAILDGFGIYDKFIEFAGGGAIVPIVSFGHSLLHGAMHQAHI 80  Bacillus subtilis
tigr:CHY_1955  83 KGILGLLGGGIANTATGISVAIIAGYIIALIFKPKG 118 Carboxydothermus hydrogenoformans Z-2901
BAB05260       81 SGFLGVGMGIFEITSAGISSAILFSFLVAVVFKPRG 116 Bacillus halodurans C-125
BAD64333       81 -GLFKITDGVFEIASTTIVFSILFSVAAALFFKPRG 115 Bacillus clausii KSM-K16
AAP10985       81 HGYLGIGIGMFSLTSAGISAAILCSFFIALICKPKG 116 Bacillus cereus ATCC 14579
BAD64362       81 VGLIGIITGIFEVTSAGISAAIIFGFLASLCFKPKG 116 Bacillus clausii KSM-K16
AAK80259       82 KGLIGAFTGGIKGTAAGITGAVFFGYLMALLFNSKT 117 Clostridium acetobutylicum ATCC 824
AAO36725       83 KGFIGIFTGGVTGSAGGITAAIVFGYLMAVIFNAKT 118 Clostridium tetani E88
AAM24545       81 DGLIGAFTGGLTATAGGISAAIFFGYIFALMFNPKT 116 Caldanaerobacter subterraneus subsp. tengcongensis MB4
BAA12660       81 HGFIGIGMGIFELTSAGISAAILFAFIVAVIFKAER 116 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap