Conserved Protein Domain Family

TIGR02839: spore_V_AE 
stage V sporulation protein AE
This model describes stage V sporulation protein AE, a paralog of stage V sporulation protein AC. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAE have a stage V sproulation defect. [Cellular processes, Sporulation and germination]
PSSM-Id: 131886
Aligned: 9 rows
Threshold Bit Score: 131.326
Threshold Setting Gi: 77997119
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
tigr:CHY_1955  83 KGILGLLGGGIANTATGISVAIIAGYIIALIFKPKG 118 Carboxydothermus hydrogenoformans Z-2901
BAB05260       81 SGFLGVGMGIFEITSAGISSAILFSFLVAVVFKPRG 116 Bacillus halodurans C-125
AAK80259       82 KGLIGAFTGGIKGTAAGITGAVFFGYLMALLFNSKT 117 Clostridium acetobutylicum ATCC 824
AAM24545       81 DGLIGAFTGGLTATAGGISAAIFFGYIFALMFNPKT 116 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap