Conserved Protein Domain Family
spore_V_AC

?
TIGR02838: spore_V_AC 
stage V sporulation protein AC
This model describes stage V sporulation protein AC, a paralog of stage V sporulation protein AE. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAC have a stage V sproulation defect. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131885
View PSSM: TIGR02838
Aligned: 10 rows
Threshold Bit Score: 194.443
Threshold Setting Gi: 18145711
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC13337       14 QQYQDFQEKREVKRPILKNCIKAFLIGGLICFIGQIISTFYIYQFQFTEQTVGNPTTATLIFITMLLTGFGVYDRIGQFA 93  Oceanobacillus...
BAB05287       14 QQYQDLAQKYELQRPVFKNCIRAFFIGGLISLIGQLLMTFFMTYFDFTEKTAGDPTIAVLIFLSALLTGLGVYDRMAQYA 93  Bacillus halod...
AAT61062        8 DDYVNKVKEYHPKPNYFINCVKAFFVGGLICTIGEVLMKFYIHYFHFSEQEAGNPTVATLVLLSAILTGCGVYDKIGQFA 87  Bacillus thuri...
AAK80261       10 TDFNNLAKAAKPKPNTVKNCLSAFIVGGIICDVGQLVSDIFSRYG-VAKSDLSMYTSTMLIFIGAFLTGIGIYDKIANIA 88  Clostridium ac...
BAB81753       10 TKFDQLEQQIRPKPKLLRNCIMAFIVGGLICVIGQFVRNTFLYYG-FTEEQVSSLTPMTMVFLGALLTGLGLYDRIAAKA 88  Clostridium pe...
AAM24543        9 QEYKNIAQKYEPKPTLLKNVVMAFIVGGLISDIGQFFLNFYLSKG-FSMEDANTLVAITMVFIGAFLTGIGVYDDIGKFA 87  Caldanaerobact...
tigr:CHY_1957   6 NEYQKTVEKIKPKPPVLKNCLLAFLMGGFVCLLGEVLFHFLRGYG-ISEKDGYTVVSVVFILISAILTGTGIYDDLVRIF 84  Carboxydotherm...
BAD39187       14 SLYRRMVARAEPSPPRLRNAVMAFVSGGLVCALGEGITDFWERVLRISHKQAADPTVATLIFLSSLLTGLGYFDKLARHA 93  Symbiobacteriu...
BAB05258        7 KQYQANIKLYQPKPNYGKNAVRAFLIGGFICLLGEAISDLYLMWFPLSERTVTAPMMATMILLAALFTGVGLYDKLGQFG 86  Bacillus halod...
BAD64331       13 EEYKENIVLYKPKSRYLKHGSLAFFSGGLICVIGQLIFRGYHALFQLSDETATSYMLITLIAIAVLATGMGFYRKGAQLF 92  Bacillus claus...
BAC13337       94 GAGSAVPVSGFGNAVISAAIEHRTEGFILGVGGNMLKLAGPVIVYGVFSAFVVALIKTILI 154 Oceanobacillus iheyensis HTE831
BAB05287       94 GAGTAVPVTGFANSIASAAIEHRTEGYVLGVGSNMFKVAGSVIVFGTFAAFIIGIIHTLVT 154 Bacillus halodurans C-125
AAT61062       88 GAGSAVPVTGFANSMASAALEHKSEGIVLGVATNMFKLAGSVIVFGVVGAYIIGLIRYTFK 148 Bacillus thuringiensis serovar ko...
AAK80261       89 GAGSIVPITGFANSIVAPAIEFKKEGFVFGVSAKMFTIAGPVLVYGLSSSVIVGVIYYLIN 149 Clostridium acetobutylicum ATCC 824
BAB81753       89 GAGTIVPITGFSNAMVSPAIEFKKEGFVMGVGAKMFTIAGPVLVYGTGTSVIVGLIYYLLL 149 Clostridium perfringens str. 13
AAM24543       88 GAGSIVPITGFANSIVSPAMEFKREGFVFGAAAKMFTIAGPVIVYGVSTSILIGIIYYFLK 148 Caldanaerobacter subterraneus sub...
tigr:CHY_1957  85 GAGLIVPITGFANSMVSPALEHKQEGLVLGVGAKLFTVAGPVIIYGVLSSLIVAIILRGLG 145 Carboxydothermus hydrogenoformans...
BAD39187       94 GAGLAVPVTGFANAMTATALEFKREGLVFGIGGRMFQLAGAVIVYGVVTAFAVGIITGIAR 154 Symbiobacterium thermophilum IAM ...
BAB05258       87 GAGALVPVTGFTNAMASAALEHRSEGLVHGVATNMFKMVGAVIVFGVVVSYLVGLTRLLVQ 147 Bacillus halodurans C-125
BAD64331       93 GAGLLVPITGFANAMAATALEHRTEGLLTGVGSNLFRLIGPVLVFGISTAYLVSFSRLLIR 153 Bacillus clausii KSM-K16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap