Conserved Protein Domain Family
spore_II_R

?
TIGR02837: spore_II_R 
stage II sporulation protein R
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage II sporulation protein R. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131884
View PSSM: TIGR02837
Aligned: 6 rows
Threshold Bit Score: 251.189
Threshold Setting Gi: 20517560
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK80840   3 KKIFIVIILAIFYItFMSMNYVLAYSDsglnKDNIQISIAKKVIRFHVLANSDSDADQNLKLKVRDAVINYMRPKLQNCK 82  Clostridium acetobu...
BAB81917   2 KKILSVLFLGVICL-FIVGSSLNTRQAlgvtEENVVEDISEKLIRFHVLANSDSDVDQDLKLRVKDEVLKYISPILNESQ 80  Clostridium perfrin...
AAM25676   2 KKIIAVLLIAIISIlVISGKTSENRTN--------VDSWSKKLIRFHVIANSDSPEDQELKLKVRDAILVELAPKLEGLK 73  Caldanaerobacter su...
BAD40208   3 RKLITGWLLIVLGLgQAGGGVLLAAAA----RAEDAALADPNLVRIHVIAHSDSPEEQALKLAVRDAVLDRLRPALSGAR 78  Symbiobacterium the...
P39151     3 KTVIICIYIFLLLSgALVGLAKEETAQk---SENQPVVIPDQAIRLRILANSDSDQDQQLKRHIRDAVNKEITTWVKDIT 79  Bacillus subtilis s...
BAB07492   3 QKVVIYLLFSLFVLvLSYESQSYHAAL-----AHHQEVGEEEAIRLRILANSDAIKDQMVKRNIRDVVNGQITEWVTGLD 77  Bacillus halodurans...
AAK80840  83 DINQSRKVLLNSDSSIKRIADSVIKKNGYQYKVNTELAKVDFPVKSYGNIVLPEGKYEAYRILIGQARGHNWWCVMFPPL 162 Clostridium acetobu...
BAB81917  81 SLEESREILKREDKNIIKIAEDYIKSQGFDYTVETTLTRENFPVKEYGNIVLPQGEYEAYRILIGEGKGQNWWCVMFPPL 160 Clostridium perfrin...
AAM25676  74 TKEESERVIKENLVNIEKVAEKIIKEEGKDYKVRVDYGVFSFPTRYYGALTVPAGKYTALKVVIGEGEGKNWWCVVFPPL 153 Caldanaerobacter su...
BAD40208  79 SRAEAEARIAVLLPELEQAARAVAAAWGAAHPVRAELGTYAFPGKGYGDLYLPAGRYRALRILIGDAAGANFWCLVYPSF 158 Symbiobacterium the...
P39151    80 SIEEARRVIRSKLPEIKAIAKETMEKEGANQSISVDFDKISFPTKLYGNMVYPAGEYEAILITLGNGDGANWWCVLFPPL 159 Bacillus subtilis s...
BAB07492  78 DLDDAKQMIRENLPEIDRMVESELAALGLEQDYTVSFTQAQFPTKLYGNIVYQAGIYDTVLITLGEGNGENWWCVLFPPL 157 Bacillus halodurans...
AAK80840 163 CFTDITRGAVEE 174 Clostridium acetobutylicum ATCC 824
BAB81917 161 CFIDVTKGQVAY 172 Clostridium perfringens str. 13
AAM25676 154 CIVDAKHGFTDE 165 Caldanaerobacter subterraneus subsp. tengcongensis MB4
BAD40208 159 CYTIREVQVPPT 170 Symbiobacterium thermophilum IAM 14863
P39151   160 CFLDFSNGEAVK 171 Bacillus subtilis subsp. subtilis str. 168
BAB07492 158 CFLDMASGDAVD 169 Bacillus halodurans C-125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap