Conserved Protein Domain Family
spore_IV_A

?
TIGR02836: spore_IV_A 
stage IV sporulation protein A
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131883
View PSSM: TIGR02836
Aligned: 4 rows
Threshold Bit Score: 843.306
Threshold Setting Gi: 28203271
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P35149          1 MEKVDIFKDIAERTGGDIYLGVVGAVRTGKSTFIKKFMELVVLPNISNEADRARAQDELPQSAAGKTIMTTEPKFVPNQA 80  Bacillus subti...
AAO35714        1 MENFDIYKDIAERTQGDIYVGVVGPVRTGKSTFIKKFMELMVIPNIDNEYKKKRAQDELPQSSSGKSIHTTEPKFVPNEA 80  Clostridium te...
tigr:CHY_1916   1 MERVDLFRDIAQRTSGNIYISAVGPVRTGKSTLIKKFMELLILPNIKNVYDRERAKDELPQSGAGRTIMTTEPKFIPNEA 80  Carboxydotherm...
AAM24818        1 MEGYDIYRDIAERTQGDIYIGVVGPVRTGKSTFIKRFMDILVLPNLEEAPLKERIRDELPQSAAGKTVMTTEPKFVPEKA 80  Caldanaerobact...
P35149         81 MSVHVSDGLDVNIRLVDCVGYTVPGAKGYEDENGPRMINTPWYEEPIPFHEAAEIGTRKVIQEHSTIGVVITTDGTIGDI 160 Bacillus subti...
AAO35714       81 VEINLNEGTKFKVRMVDCVGYIVKGAQGHMEEGKAKMVSTPWYDYEIPFEEAAEIGTKKVINEHSTIGILVTTDGTIADI 160 Clostridium te...
tigr:CHY_1916  81 IEININSSVKANVRLVDVVGYPVLGALGYEEEDGPRMVLTPWFDEEIPFAEAAEIGTRKVITDHSTMAFLVTTDGSITDI 160 Carboxydotherm...
AAM24818       81 VEITINENTKFKVRLVDCVGYMVKGALGYMEGDKPRMVSTPWYDYEIPFEEAAEIGTRKVISDHSTIGLVVTTDGSITEI 160 Caldanaerobact...
P35149        161 ARSDYIEAEERVIEELKEVGKPFIMVINSVRPYHPETEAMRQDLSEKYDIPVLAMSVESMRESDVLSVLREALYEFPVLE 240 Bacillus subti...
AAO35714      161 NREDYVETEERVVEELKEINKPFIILLNSRNPLSPETIELRKEMEEKYDVPVQIMDILNMKEQDIISVFSRVLKEFPIQE 240 Clostridium te...
tigr:CHY_1916 161 PRENYLAAEERVVEELKQLEKPFIIVLNSTHPNAPETKALAEELEQKYDVTVVPVDVAEIGINDLNALLENLLYEFPLVD 240 Carboxydotherm...
AAM24818      161 PRENYVPAEERVIKELKELNKPFIILLNTTHPQNTETMNLASELEKKYDTPVIVVNVMQMEIKDIYKILEKVLFEFPIRE 240 Caldanaerobact...
P35149        241 VNVNLPSWVMVLKENHWLRESYQESVKETVKDIKRLRDVDRVVGQFSEFEFIESAGLAGIELGQGVAEIDLYAPDHLYDQ 320 Bacillus subti...
AAO35714      241 INIDMPGWIEKLDRSHWLKLNFINLVKDMSKNVYKVRDVAKVVEEIKEAEFLEKSILDEMNMGEGTARVVLSPKNGLFYK 320 Clostridium te...
tigr:CHY_1916 241 VNFNLPQWIEELDATHWLKEKFTSAVHEALKNVKKVKDINNAVARLSENEYVDNVELENLDMGTGQASIKVAAKEGLFYR 320 Carboxydotherm...
AAM24818      241 IAIDLPTWVDALDKNHWFKENVLSTVKESVKDLYRLRDISNLVGGLKANENFSEVFIKKIAPGEGSANIEIKTHEGLFFK 320 Caldanaerobact...
P35149        321 ILKEVVGVEIRGRDHLLELMQDFAHAKTEYDQVSDALKMVKQTGYGIAAPALADMSLDEPEIIRQGSRFGVRLKAVAPSI 400 Bacillus subti...
AAO35714      321 ILGEICNREIEDENHLMDIMKDMNKAKLEYDKIEGALVDVKELGYGLVAPELSEMKLEEPEIVKQGNRYGVKLKASAPSL 400 Clostridium te...
tigr:CHY_1916 321 VLEEVSGYAIRGEHELLRLMRELSYAKKEYDKVAIALKEVKETGYGVVTPRLEEMNLEEPELIRQGNRFGVRLRASAPSM 400 Carboxydotherm...
AAM24818      321 ILSDESGLTIKNDKELMSVIKELAHAKRQYDRIKEAFLKAQETGVGVVPASLEEMKFEKPEIVRQGGRFAVRLKASAPSY 400 Caldanaerobact...
P35149        401 HMIKVDVESEFAPIIGTEKQSEELVRYLMQDFEDDPLSIWNSDIFGRSLSSIVREGIQAKLSLMPENARYKLKETLERII 480 Bacillus subti...
AAO35714      401 HFIKADIETEISPIMGTERESEELVKNLLEQFESDPSKIWESNMFGKSLEVLVKEGLQSKLYKMPEDVQVKIQKTLQKII 480 Clostridium te...
tigr:CHY_1916 401 HIIRADITTEITPIIGTEKQCEELVQYMLKEFEENPKKIWESEIFGKSLHDLVREGIQNKLHRMPENAQVKLQETLQRIV 480 Carboxydotherm...
AAM24818      401 HIFRTDITAEVTPVVGTEKQSEDFVKYITEQFENAPEKIWESNIFGKTLSDLVKEGMQNKVSAIPENLSHKLRDTLEKVV 480 Caldanaerobact...
P35149        481 NEGSGGLIAIIL 492 Bacillus subtilis subsp. subtilis str. 168
AAO35714      481 NEGNGGLICIIL 492 Clostridium tetani E88
tigr:CHY_1916 481 NDGGGGLICIII 492 Carboxydothermus hydrogenoformans Z-2901
AAM24818      481 NDSGGGIIFIII 492 Caldanaerobacter subterraneus subsp. tengcongensis MB4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap