Conserved Protein Domain Family
spore_sigmaE

?
TIGR02835: spore_sigmaE 
RNA polymerase sigma-E factor
Members of this family comprise the Firmicutes lineage endospore formation-specific sigma factor SigE, also called SpoIIGB and sigma-29. As characterized in Bacillus subtilis, this protein is synthesized as a precursor, specifically in the mother cell compartment, and must cleaved by the SpoIIGA protein to be made active. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131882
View PSSM: TIGR02835
Aligned: 5 rows
Threshold Bit Score: 402.662
Threshold Setting Gi: 20516645
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAO35702       28 FKLKVFLNKILSKLKIFARNIYYIGGSDVLPPPLTREEEENLVEKLNYGDESIRSILIERNLRLVVYIARKFENTGIGIE 107 Clostridium te...
P62179          6 FYLVYLWYKVLLKLGIKTDEIYYIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVYIARKFENTGINIE 85  Bacillus thuri...
AAM24839        9 IELLLIWRKLLDFLDL-AEEVYYIGGSEALPPPLSVEEESYLISKMEKGDNEAKSILIERNLRLVVYIAKKFENTGVGIE 87  Caldanaerobact...
tigr:CHY_2056   4 KKFFFWLKNLFKKFFERPGEVYYIGSHDILPPPLSSEEENTLLTLLVQGDAAAKSTLIERNLRLVVYIARKFENTGVNIE 83  Carboxydotherm...
BAD40206       18 RVSTRVLRWLAARGLVRPRAIYYVGSSEALPPPLTGEEEAALLQRLTQGDESVKNTLIERNLRLVVYIARKFDNTGIWVE 97  Symbiobacteriu...
AAO35702      108 DLVSVGTIGLIKAVNTFDPSKKIKLATYASRCIENEILMYLRRNNKIKSEISFYEPLNVDWDGNELLLSDILGTDTDIVY 187 Clostridium te...
P62179         86 DLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNKNRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIIT 165 Bacillus thuri...
AAM24839       88 DLISIGTIGLIKAINTFNPRKKIKLATYASRCIENEILMYLRRNNKTRLEVSFDEPLNVDWDGNELLLSDILGTDNETVY 167 Caldanaerobact...
tigr:CHY_2056  84 DLVSIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMYLRRNSKIRLEVSFDEPLNVDWDGNELLLSDVLGTEGDIIY 163 Carboxydotherm...
BAD40206       98 DLVSIGTIGLIKAVKTFDPSKRIKLATYASKCIENEILMYLRRASRTRSEVSFDEPLNKDWEGNELLLSDVMGTDSDITY 177 Symbiobacteriu...
AAO35702      188 DYIEEEVDKELLLIAMDKLNNREKQIVNLRFGLGGKTEKTQKEVADMLGISQSYISRLEKRIIKRLKKEINKMI 261 Clostridium tetani E88
P62179        166 KDLEATVDRHLLMKALHQLNDREKQIMELRFGLAGGEEKTQKDVADMLGISQSYISRLEKRIIKRLRKEFNKMV 239 Bacillus thuringiens...
AAM24839      168 KYIEDEVERELLTSALKKLPDREKKIIRLRFGLEGGTEKTQKEVADMLGISQSYISRLEKKILKRLKKEMNRLV 241 Caldanaerobacter sub...
tigr:CHY_2056 164 KVMEDEVEKKLLKVALSKLNQRERKIMELRFGLTDGYERTQKEVADLLGISQSYISRLEKKILKRLKKEIIRME 237 Carboxydothermus hyd...
BAD40206      178 RGLEEEVDRMLLRKAMAKLTGREKRIMELRFGLVDGRERTQKEVADLLGISQSYISRLEKRIFKRLKKEILRME 251 Symbiobacterium ther...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap