Conserved Protein Domain Family
spore_III_AB

?
TIGR02833: spore_III_AB 
stage III sporulation protein AB
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131880
View PSSM: TIGR02833
Aligned: 10 rows
Threshold Bit Score: 203.7
Threshold Setting Gi: 77995677
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK80051        3 KFVGCILIITSSTIVGFRYAEHFRKRVKELKEIHNSLYELRNEIIYTHTPLVEAFKNISDRSNYPVNLFFKLAAENLCYK 82  Clostridium ac...
AAM24508        2 KLIGVILTIFSTTSIGYLMAMKFKARRWILKSLISALNLLKLEITYSRTPLERALKKVALSSDKTVGELFQRASLHLGEQ 81  Caldanaerobact...
tigr:CHY_2006   4 KLLGACLTVTGTGALGFYLGNRYLQRVRNLERLINLLNFLKTEIRYKATPLPEIFAKMANSEEGTVAKLFE-----IKDR 78  Carboxydotherm...
AAO36133        4 KLLGALLTIASSTAIGFLYSNKFKKRVYQLKSIERAVYEIKNEILYTYTPLPELFSKTSEKSSFPINKLFESISNLLKTN 83  Clostridium te...
BAB81538        2 KVFFLLIIVLLSSLIGYLYGEGFRNRLSQLRELKRALIDFENDIVYTYTPLPESIESIALKAKSPIKELFNEISFKLKNN 81  Clostridium pe...
BAC13849        2 KWIGALLLIGTATTIGFEWSNRLKQRPKHIRQVINALQVLEAEMVYSQVSLQAAFLIIAQKSPDPIRLFFQGMAEQMDRI 81  Oceanobacillus...
BAB06515        2 KLLGAIFILMATTWAGFELARRLHERPRQLRQLKVALQSLEAEMVYGLTPLAEATGHIAAQMPKPVSYLFEHFSYRLKEK 81  Bacillus halod...
Q01368          3 KLLGAVFIVVATTWTGFEMAKIYTERPRQIRQLRAALQSLEAEIMYGHTPLHTASQQIAKQLAQPVSTLFSAFSDQLDKG 82  Bacillus subti...
AAT62827        3 KIFGAVLIVAVSTFFGFSYAKRYSERPRQLRLLKAALQSLEAEIMYGHTPLSEAAERLVKQMPKPLNWIFQSFANRLESG 82  Bacillus thuri...
BAD40846        4 KLLGAALTVLAPSWIGFQIAARYARRPAELRGFQNGLAVLVTEVEYGATPMPDALRSAARASGPVAGAVLADAADRLEGG 83  Symbiobacteriu...
AAK80051       83 ETDNVYSAFKCVFDTdKFQTNLNNDDKKILLNLSKSLGETDIEGQVKVFELAIKNIENHITEAEEIMKKNVKMYRCLGFC 162 Clostridium ac...
AAM24508       82 SGLTAGEAWEKALNE-WERGYLSKEEKEILRAFGTILGISDAGNQEKNFNLTMDLLKRQLNLAEEEGKKNEKLYQNLGFL 160 Caldanaerobact...
tigr:CHY_2006  79 T-LPVNQGLKKALAEgFSQTALLKREQEILLAFAEKIGISDLREQENLLNYTCEQLKLVLAESRQEAEKNVKLVNYLGVL 157 Carboxydotherm...
AAO36133       84 AVNSVYEAFIKGFQKvEDKMELKKEDKDLILNLAKTFGESDVQGHMNIISLTLEGLKKQITEGEIAMKKNIKMYRYLGFT 163 Clostridium te...
BAB81538       82 EVENVYMAFKESINEhKKEMNLRNKDFEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYLGVA 161 Clostridium pe...
BAC13849       82 P-FDFDQIWQEQVSQlLINSALQSSEEEILLQFGKSLGQHDIEQQQKHIHLTKVYLENQLTEAQDAYQHYGKLSKTLGVL 160 Oceanobacillus...
BAB06515       82 E-ETVYDAWEAAINEtWKYTALLASEREVILQFGATLGQHDREQQQKQVRLTLAHLEREEGEARDKQYRYERMMKSLGVL 160 Bacillus halod...
Q01368         83 S-DSAKTAWEQSLKKvWDTLSLKKSEYEVLKQFGETLGIHDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSLGFL 161 Bacillus subti...
AAT62827       83 E-QTVREAWIDSLKEnWKLTAFQQTEYEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKVLQIQYEKMIKSLGVL 161 Bacillus thuri...
BAD40846       84 GGITPGEALAAALEErRGATCLTPADQEILAALVPVLGASDRRDQVRHLRLALERLAAAEAEATDERRRYEKMYRYVGVL 163 Symbiobacteriu...
AAK80051      163 VGAMITIMIV 172 Clostridium acetobutylicum ATCC 824
AAM24508      161 LGLAIVILFL 170 Caldanaerobacter subterraneus subsp. tengcongensis MB4
tigr:CHY_2006 158 VGAFLVLLFF 167 Carboxydothermus hydrogenoformans Z-2901
AAO36133      164 IGMMIVITLF 173 Clostridium tetani E88
BAB81538      162 VGAMIAIFLV 171 Clostridium perfringens str. 13
BAC13849      161 CGLFLVLLFI 170 Oceanobacillus iheyensis HTE831
BAB06515      161 AGLLIILMML 170 Bacillus halodurans C-125
Q01368        162 AGLLLILLLM 171 Bacillus subtilis subsp. subtilis str. 168
AAT62827      162 AGLLIVILLL 171 Bacillus thuringiensis serovar konkukian str. 97-27
BAD40846      164 SGLALVLILI 173 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap