Conserved Protein Domain Family
spo_yunB

?
TIGR02832: spo_yunB 
sporulation protein YunB
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. Mutation of this sigma E-regulated gene, designated yunB, has been shown to cause a sporulation defect. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131879
View PSSM: TIGR02832
Aligned: 8 rows
Threshold Bit Score: 238.758
Threshold Setting Gi: 52004943
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
novoz:BL02146     14 LPLRYVMLLSFIFFIFSTAVSLLIINSSIKPTLLNIAEMETNRIATHVIQEAVEDYMS-QDENVKNLVEMKTNENGKVTT 92  Bacillus li...
AAM24884          11 YRRVKGLYIYLIYTIVALIFFYYFTEYRLKPAIIAVSETLAKETAVNTINDAINERVL-KGIEYKDLVYVRTDNNGKVSM 89  Caldanaerob...
BAA34252           3 FNIKAKLISLIICIIIIIITFVYLFDSIVTPTVLAVSEAEMRAKTIEIINGCIIDEVE-KGFNYNDIIKIDKDDEGNISL 81  Clostridium...
AAK80256           7 KKTKVIIIIILTFMLVLFNSVIYAFDKLITPVAIKTADSQIKSKITEIVNVNMSKVYN-QNYSYNKIIEIDKDNDGNIVM 85  Clostridium...
BAD40108          45 LRVRRIWLRNLILAAAVLYLLIRIGDLLLMQPLKAVAEVEARRLGAAAVNRVVAAQVS-KSLAGAQVVEYVRDESGRIAA 123 Symbiobacte...
tigr:CHY_1560     10 YQIRRIK-VFVTLMLLFTLTFTWIVERYIGDLFLNLAKVRINQIITEEFTKVVLQEIEsEEFQTEKLIRIEKDQKGKITL 88  Carboxydoth...
jgilanl:BCZK4700  16 ISFRHILLMSFILFVILLVQGLWIVNSSIQPTLMKYGEVETHKMATAVMTKAVKDRID-EGFDVDSLMKVQNDKNGKVST 94  Bacillus ce...
BAD65487          19 LPFRYVLLISSVLFALLSLQGLWFVDQQLRPIISQIAHREMERIATYTIQQALTDELG-QT-DMNDMLITETNGDGQITY 96  Bacillus cl...
novoz:BL02146     93 IDFNSHGLSGMHSKITKQLHEKLKETETeefnssaktpegkndgVIYNIPLGQATGNSLLGNLGPKIPVRFNVVGDVFTD 172 Bacillus li...
AAM24884          90 LQANTIEMNLLASKITREVKENLNSIGP----------------LYAKIPLGSVFSSDLFANVGPRIKVGLLPVGAVDVD 153 Caldanaerob...
BAA34252          82 IRADILKLNKIASNISLKGQKKLNELGR----------------IGIKLSLGYITKNNILSYIGPDIAVKMEPTSNVETT 145 Clostridium...
AAK80256          86 MKANTIILNKLACDVALESQYDINKLGE----------------VGIKMPLGYIFKNNILSYMGPELTIKAQQIGHVETK 149 Clostridium...
BAD40108         124 YHVNTPLVNRVASEAAVAVQEELKRLAE----------------TPVRLPLGALTGSALLSNLGPRLSVQLVPVGSVSIT 187 Symbiobacte...
tigr:CHY_1560     89 VQSNTLLFHKLAARIGNRMQKHINLLRK----------------QKVAIPFGQLFGLKVLASFGPKIKISFIPMGYVEVN 152 Carboxydoth...
jgilanl:BCZK4700  95 INLNTKQVNEIVTSTTTYIEKYLQQVEEgnlngig---isekngATMAVPFGRVTNNALLGNIGPDIPIDFTTIGHVNTD 171 Bacillus ce...
BAD65487          97 VTLDTQKYNKLLGNVQHRVHEAINAIQRnednty-----gasegTVATIPLGRALNNSLLNDVGPGIPLRFALIGDAKVG 171 Bacillus cl...
novoz:BL02146    173 FKQSVEPYGINNALINVGVLVEVKVRVVIPFATKTAVVKNTIPATIQAVHGEVPDFYSGNG 233 Bacillus licheniformis DSM 13 ...
AAM24884         154 FSSQFEPAGINQTRHRIYLDIRTTIRIIAPLTSDEVQVTLHMPIAESIIVGDVPASYVDVN 214 Caldanaerobacter subterraneus ...
BAA34252         146 YSSIFKSAGINQTSHKIFIKFKTKIRIIIPLKSVDVEVYSEMPISETIIVGKIPDSAIQLD 206 Clostridium histolyticum
AAK80256         150 YLSKFEGAGINQTRHIIMILVKTKVRVMIPMAYDDIEIKNEIPVAETIIVGKIPNSALGLS 210 Clostridium acetobutylicum ATC...
BAD40108         188 VQQEFKGEGINQTRHRVWLEAAATMRIILPLTTQEVPLVQELPLADTVIVGPVPNALYGGS 248 Symbiobacterium thermophilum I...
tigr:CHY_1560    153 CLDSFESGGLNQTRFQLSVILKASYKVAIPLVSEEAKLSYKLPIIETVIVGEVPQIMLPSS 213 Carboxydothermus hydrogenoform...
jgilanl:BCZK4700 172 IKQKIEPHGINTTAIQIIMEMEVTLQVIIPFHTKEIKVKQNVPIATRIVQGEVPTYYGSGS 232 Bacillus cereus E33L
BAD65487         172 MKDESEQLGINNTRLSFYVTIEVGMDVILPFSETADTVSVELPAGFAFISGEVPQFYGGQL 232 Bacillus clausii KSM-K16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap