Conserved Protein Domain Family
spo_II_M

?
TIGR02831: spo_II_M 
stage II sporulation protein M
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This predicted integral membrane protein is designated stage II sporulation protein M. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131878
View PSSM: TIGR02831
Aligned: 9 rows
Threshold Bit Score: 179.379
Threshold Setting Gi: 20516316
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P37873     8 DMFLRHVKDHLSLYIFVSVLFFMGVIFGAIIVNSMTISQKEDLYYYLSQFFGQLS-DGKQASSADMFGQSIFHNAKYLGL 86  Bacillus subtilis s...
BAC13806   5 YVVFNHFKHHATIYIFTTILFLTGIVFGAVIVNSMDVVQKQDLFFYLERFFIQTTeEGSTLNNNDILWQSFFYHIKYLGL 84  Oceanobacillus ihey...
AAP11011   8 DRVMSHIQENSSLYIFNAVLLLMGVIFGAILVNSLQINQKQDLSFYLQRFFGQVS-KGEFAIAGEMFRESYFSQLKYIGF 86  Bacillus cereus ATC...
BAB05245  12 ESMHRHLYDNQAIYLFTIVLFLVGIVFGAIVVNSLSITQKHDLYMYLQQFFGQVS-DGHVATSTEMFKQSFSHYAKYFGL 90  Bacillus halodurans...
AAK80027   7 EAISNHIKERFWLYIISSLSIGIGFVISVYTVKYMSSYEKNDLMSYILNFTKNK--GTVSINYNGVLFQTLKDNIPLIII 84  Clostridium acetobu...
AAO36084   8 NSLADHFRENFWIYVVTLLFIFIGIVLGIYSVKYINSVHSNELLNYFNNFINHI--GNNNIEYKTVFYQILKNNIPTIFI 85  Clostridium tetani E88
BAB81515   6 SGLMESLKENKITFLWVLLFFLVGIVLGSYTVYYMSDFNRVEITTYFNNFLEFL--GGNSVSYTSILIDSIKSILPMVAI 83  Clostridium perfrin...
AAM24536   6 AGFYSHIRGNFFLYVLVLTALMIGTTTGAFTVNNITDIQREQIREYISKFYQIA--KTIELSPVQIFKQSLLNNFVTVFL 83  Caldanaerobacter su...
BAD40808   9 ENLEELLLERGGLVLWHTALFVVGLLFGALALRSLEVETQLELARQISGALQALR-EGEPPAPGPLLREALFRQARTVAL 87  Symbiobacterium the...
P37873    87 MWILGISVIGMPIIFIMIFLKGIVVGFTVGFLVNQMGVSGFFLSFVSVLPQNVLLIPAYLIMGTCAIAFSLKLIRQLFVK 166 Bacillus subtilis s...
BAC13806  85 MFIFALSVIGLPIVWILIFIKGMVVGFSVGFMVNWLGMDGLILSAISIAPQNIVIIPIYIIAGSICMIFSLGLLSKLVAK 164 Oceanobacillus ihey...
AAP11011  87 IWILGISIIGLPLIFILLFVKGVVVGFTVGFLVSQHGWNGLLLAFVSVLPQNLIIIPVFLVMTTIAASFSLRMIRHQFIR 166 Bacillus cereus ATC...
BAB05245  91 MWILGLSIIGLPVILVLLFLKGVVIGFTVGFLVSQMGMNGFFLSFVSVLPQNLILVPAFIIIGTASVSFCLKMIRNQFVK 170 Bacillus halodurans...
AAK80027  85 IWFLGLTMIGIPVILIIDLLKGFSLGFTITFFVNNLGIKGVTMAFLGVLPQNLIYIPCILFVSVIAMEFSIGLVRCGFND 164 Clostridium acetobu...
AAO36084  86 IWFLGMTLVGLPGILIIDILKGYTFGFTISFLINSNGIKGLWMVLLALIPQNIIYISCILVASVLAMDFSLNFVKERVNK 165 Clostridium tetani E88
BAB81515  84 IVLLGYTAVGTPIILMMDLAKGYVIGFTFSLIVSMLGSKGIMLVLSGLMLQNLIFIPIIMLISVLAIRHSVTKLKMGVSR 163 Clostridium perfrin...
AAM24536  84 LWILGATIIGIPFIFLIVGMRGFTLGFSIGVLIKEMQMKGVLLTLLGVLPQNIFILLGILFTSVTAINFSVYLLK---NK 160 Caldanaerobacter su...
BAD40808  88 MWVLGVSLVGSVAVMALPLVRGFTSGFAVAYLTAELGARGVLLAAAGHLPQTVLEVPGVILAASASVGFAVEVLTSWRVR 167 Symbiobacterium the...
P37873   167 RsLHDAPIQWFGRYAFVLLVILFLALISSLFEAYLSPVLMEK 208 Bacillus subtilis subsp. subtilis str. 168
BAC13806 165 R-NNTSLSQPFIKLTTSFVILIVCTGLAAILEAYISNTMMVE 205 Oceanobacillus iheyensis HTE831
AAP11011 167 K-ITEPLLPLLIRYTCFFLVIGVVLALASSVEAYASPVLMKE 207 Bacillus cereus ATCC 14579
BAB05245 171 G-INEPFFPQFLQYSMLILCVGASSLIASGIEAYMSPLLMRM 211 Bacillus halodurans C-125
AAK80027 165 G-IRNRIFTRIGSYSLVFAFAAIFMGMGFLFETYCTPNIIKL 205 Clostridium acetobutylicum ATCC 824
AAO36084 166 T-FGQGLGVRILYYSLSFIFIISVMFVGFFMETYVTPSIMKI 206 Clostridium tetani E88
BAB81515 164 DrVKLDVSRAYLNFQGLL---SLIIISGILIETYISPNLIRL 202 Clostridium perfringens str. 13
AAM24536 161 KfYFEELASQFISYTFAIYAGFLFIMLGCLIESYLTPYVLLL 202 Caldanaerobacter subterraneus subsp. tengcongensis MB4
BAD40808 168 R-RLSGYYDALARYSNTLLCAAVLLAAAALVEGYVTPHLVRL 208 Symbiobacterium thermophilum IAM 14863
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap