Conserved Protein Domain Family
TIGR02828

?
TIGR02828: TIGR02828 
putative membrane fusion protein
Members of this family show similarity to the members of TIGR00999, the membrane fusion protein (MFP) cluster 2 family, which is linked to RND transport systems. [Transport and binding proteins, Unknown substrate]
Statistics
?
PSSM-Id: 131875
View PSSM: TIGR02828
Aligned: 3 rows
Threshold Bit Score: 246.697
Threshold Setting Gi: 77996365
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM24805      196 AGIISYTFEGVEDILNTKNMFDLKIPKLSNLVFENKE--VSGEVKEGQPVVKIVDNFDW-YLAVILEDKQASL---LKEE 269 Caldanaerobact...
BAD40211      102 SGVVFYQTDGLEEVLTPEAVAGWGPEAFSTLPYPDTReiADGPVEAGEPLFKLVDDLSLeMLLRVSADSLSESqqaVLPG 181 Symbiobacteriu...
tigr:CHY_2044 118 NGIFVPNTDGLE-FIGPDNIETLNPSKILEL-YQPRK--VEGDAVEGQPLGKIIDNLNP-ILLVIPKLSLRDN---LVEG 189 Carboxydotherm...
AAM24805      270 SGIKILFSDYPNEMRGRVIKVYKGDDKLYVGIIKMIDEYp-DFYKKSKADVEIKLKECWGLKIPVSAIAVENGKEGVWVL 348 Caldanaerobact...
BAD40211      182 QEVELQVSGRDLPLTARVVRLAAAGPDLLVHLEAPLPSA--DALRLRRMRVSLLLAEYEGIILPRAAIDVEQGRTGVWIA 259 Symbiobacteriu...
tigr:CHY_2044 190 REYRLNINEK-YELKANFLR-KNGEVALF-----SINFYpdELLNQRKVSVFIKTKEYSGFWVPVSAVKQIAGKTYIYTL 262 Carboxydotherm...
AAM24805      349 KNGTSkpVFKEIEIEISDGSYAIVKGLKIYDRVLLQK 385 Caldanaerobacter subterraneus subsp. tengcongensis MB4
BAD40211      260 QRGGY--RFVPVRVLGGTADEVAVEGDVPPDAQVLTA 294 Symbiobacterium thermophilum IAM 14863
tigr:CHY_2044 263 KNEEV--VLTPVKVVLSRENNVLVEGEKESKDELIGK 297 Carboxydothermus hydrogenoformans Z-2901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap