1ZSV


Conserved Protein Domain Family
B4_12hDH

?
TIGR02825: B4_12hDH 
Click on image for an interactive view with Cn3D
leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase.
Statistics
?
PSSM-Id: 131872
View PSSM: TIGR02825
Aligned: 4 rows
Threshold Bit Score: 653.987
Threshold Setting Gi: 23503081
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZSV_A  24 TKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGT 103 human
Q91YR9   4 AKSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDRMMGEQVARVVESKNSAFPKGT 83  house mouse
Q28719   4 AKNWTLKKHFHGHPTDSDFELKTVELPPLNNGEVLLEALFLSVDPYMRLGSKRLKEGDTMMGQQVARVVESKNPAWPVGT 83  rabbit
Q14914   4 TKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGT 83  human
1ZSV_A 104 IVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAK 183 human
Q91YR9  84 IVAALLGWTSHSISDGNGLTKLPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVKGGETVMVSAAAGAVGSVVGQIAK 163 house mouse
Q28719  84 LVLAHSGWASHSISDGQQLEKLLTEWPDTLPLSLALGTVGMPGITAYFGLLEICGAKSGDTVLVNAAAGAVGAVVGQIAK 163 rabbit
Q14914  84 IVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAK 163 human
1ZSV_A 184 LKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAIS 263 human
Q91YR9 164 LKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAIS 243 house mouse
Q28719 164 IKGCRVVGAAGSEEKVDYLKKIGFDFAFNYKTVKSLEETLKKAAPDGYDCYFDNVGGEFSNTVIRQMKKFGRVAICGAIS 243 rabbit
Q14914 164 LKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAIS 243 human
1ZSV_A 264 TYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLG 343 human
Q91YR9 244 QYNRTGPCPQGPAPEVVIYQQLRMEGFIVNRWQGEVRQKALTELMNWVSEGKVQCHEYVTEGFEKMPAAFMGMLKGENLG 323 house mouse
Q28719 244 MYNSTGQLPPGPSPESVLYQEIRMEGFIFNRWKGEVGQKALKELLTWVLEGKIQYREFVIEGFENMPAAFMRMLKGENVG 323 rabbit
Q14914 244 TYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLG 323 human
1ZSV_A 344 KTIVK 348 human
Q91YR9 324 KTIVK 328 house mouse
Q28719 324 KARSE 328 rabbit
Q14914 324 KTIVK 328 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap