Conserved Protein Domain Family
adh_fam_2

?
TIGR02822: adh_fam_2 
zinc-binding alcohol dehydrogenase family protein
Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). The gene neighborhood of members of this family is not conserved and it appears that no members are characterized. The sequence of the family includes 6 invariant cysteine residues and one invariant histidine. It appears that no member is characterized. [Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 131869
View PSSM: TIGR02822
Aligned: 3 rows
Threshold Bit Score: 559.923
Threshold Setting Gi: 54016368
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK46182  13 AWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEGDLPVHRERVIPGHEVVGEVIEVGsavgaAAG 92  Mycobacterium tuber...
BAD57738   9 VWRVVEPGPVGSGALRCEREEVPRPGEGELLVRVAACGVCRTDLHVVEGDLSVHRAGVTPGHEVVAEVVAAP-----MGE 83  Nocardia farcinica ...
BAC68851   3 AWEVERPGPIEDGPLRFVERPVPVPGPGELLVRVRACGVCRTDLHVSEGDLPVHRPRVTPGHEVVGVVAGRG-----ADA 77  Streptomyces avermi...
AAK46182  93 GEFDRGDRVGIAWLRHTCGVCKYCRRGSENLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGY 172 Mycobacterium tuber...
BAD57738  84 QRFPVGSRVGIPWLRYTCGVCRYCRRGAENLCPHSRYTGWDDDGGYAEYATVPADYALALPTGYADEELAPLLCAGIIGY 163 Nocardia farcinica ...
BAC68851  78 GGYAVGDRVGVAWLRRTDGTCRYCVRGAENLCPASEYTGWDTDGGYAEYTTVPAAFAYRLPTDVDDVALAPLLCAGIIGY 157 Streptomyces avermi...
AAK46182 173 RSLLRTELPPGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVPLDAAILFAPVGD 252 Mycobacterium tuber...
BAD57738 164 HALLRAQLPEGGVLGIYGFGGSAHLTAQVALAQGARVHVMTRGAAARELAAALGAASVHGATDPPPEPLDAAILFAPAGE 243 Nocardia farcinica ...
BAC68851 158 RALVRASLPPGGRLGLYGFGGSAHLCAQVALAQGATVHVLTRDPASQRLALALGAASAGGAYDTPPEPLDSAILFAPAGG 237 Streptomyces avermi...
AAK46182 253 LVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRADARAFFDFAAQHHIEVTTPEYPLGQADRALG 332 Mycobacterium tuber...
BAD57738 244 LVPPALEALDAGGTLAVAGIHLTDVPPLNYQRHLFRERQIRSVTANTRAQAREFLAVAGQHRLRVTTHRYPLDHADRALA 323 Nocardia farcinica ...
BAC68851 238 LVPVALRALDRGGVLSVAGIHLSDTPPLCYERELFYEKELRSVTSNTRADGREFLELAARYGVRATTHTYPLSEAQQALR 317 Streptomyces avermi...
AAK46182 333 DLSAGRIAGAAVLL 346 Mycobacterium tuberculosis CDC1551
BAD57738 324 DLAAGRFDGAAVLV 337 Nocardia farcinica IFM 10152
BAC68851 318 DLKAGRFDGAAVLV 331 Streptomyces avermitilis MA-4680 = NBRC 14893
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap