Conserved Protein Domain Family
fghA_ester_D

?
TIGR02821: fghA_ester_D 
S-formylglutathione hydrolase
This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 131868
View PSSM: TIGR02821
Aligned: 6 rows
Threshold Bit Score: 498.533
Threshold Setting Gi: 58002861
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAC92367           6 ELLSSHRCFGGTVGFYRHHSETCDSPMRFSVFTPPQAAAGP-VPVLYFLAGLTCTEENFMVKAGAQRAAARYGLMLVAPD 84  Gloeobacter...
goetting:GOX2019   5 EVLAHHACFDGSLRFVRHNSQVLGVPATFGVFLPKEALAGQkVPVIHLLAGLTATQETFLIKANAIRFAAEHGIALVAPD 84  Gluconobact...
AAL53003           8 ETISTARCFDGTQGVYRHKSEACQCDMTFALFLPPQAKDGP-VPVLWYLSGLTCTHQNVMDKGEYRQLASELGIAVICPD 86  Brucella me...
WP_011317934       5 KLISEYQSFGGKLGFYSHPSFTCNGEMRFAVYQPPQAAEKP-LPILYFLSGLTCTEENFMAKSGAQRYAAEYGLILVAPD 83  Anabaena va...
WP_010975082       6 ELVTQSQCFGGTQSVYRHASEVCGVEMTFGLYMPPQARTRS-VPLLWYLSGLTCTHENAMIKAGLQRHAAEQGLALVFPD 84  Sinorhizobi...
WP_009892737       7 ELVSSHACHGGEQRFYRHESKTIGLPMKFSVYLPPQAARGR-VPALFYLAGLTCTDETFAIKAGAQRFAAQHGVALVAPD 85  Burkholderi...
BAC92367          85 TSPRKTGIPGEDDEWDFGAGAGFYVDATEEPWSLHYRTYSYVVGELPLIVAAHFPADPERTGISGHSMGGHGALVCAFKN 164 Gloeobacter...
goetting:GOX2019  85 TSPRHTGIKGEDDSYDLGSGAGFYIDATSEPWSHHYRMETYVGEELPALTERLYPLDGARRGIMGHSMGGMGALLQALKY 164 Gluconobact...
AAL53003          87 TSPRGDSIADEPDNWQFGKGAGFYVDAMQAPFAQNYRMYSYITQELSALVARQFPLDMERQAITGHSMGGHGALTIALKN 166 Brucella me...
WP_011317934      84 TSPRNTGIAGEDDEWDFGTGAGFYVDATEEPWRSHYQMYSYIVQELPALIAANFPIQAEKQGIFGHSMGGHGALVCALRN 163 Anabaena va...
WP_010975082      85 TSPRGEGVAD-DEAYDLGQGAGFYVNATQKPWSPHYRMYDYIVTELPALLQEQLPLNG-VNGITGHSMGGHGALTIAFRN 162 Sinorhizobi...
WP_009892737      86 TSPRGALVPGEADAWDFGVGAGFYLDATEAPWSAHWRMESYVAGELREIAAAELPIDGARLGIFGHSMGGHGALVLALRH 165 Burkholderi...
BAC92367         165 PTRYRSVSAFAPIAAPTRSPWGQKAFSRYLGADEKTWKSYDASALVALGT---IEPTILIDQGMADPYLEEqLRIDEFEQ 241 Gloeobacter...
goetting:GOX2019 165 PDRWKTVSAFAPICHPSIVPWGQKAFDAYFGGDPAKWQSCDPTLLLRSRHt--HPSTILVDQGLMDQYLAD-LCPDALEG 241 Gluconobact...
AAL53003         167 PDRFKSVSAFAPIVQPSTAGWSRPALEKYLGPDEQAWRAYDATLLIEDGH---RFPEILVDQGTADGFLDDgLRPWLLEE 243 Brucella me...
WP_011317934     164 PHIFKSVSAFAPIVAPIGCPWGQKAFSRYLGNNQASWRAYDASELVKQLG---YHSQILIDQGTSDKFLTEqLLTDVFAQ 240 Anabaena va...
WP_010975082     163 PELFRSVSAFAPIVNPTRSDWGRKQFSAYLGDDEADWGSYDACLLLGELG---WHGDILIDQGAADQFLDE-LQPEAMAR 238 Sinorhizobi...
WP_009892737     166 PDVYRSVSAFAPIAAPSRCPWGEKAFSGYLGADREAWQQHDASELVARAGakrFAEGILIDQGLADPFLATqLNPDVFEA 245 Burkholderi...
BAC92367         242 ACAAIGQSLLLRRQEGYDHSYYFIASFIDDHLHHHVEAL 280 Gloeobacter violaceus PCC 7421
goetting:GOX2019 242 AAKEGGQSLELRRHAAYDHSYWFVQSFIADHLTHHAKGL 280 Gluconobacter oxydans 621H
AAL53003         244 ACRKAGIALTLNMREGYDHSYFFISTFMGDHLRWHSERL 282 Brucella melitensis bv. 1 str. 16M
WP_011317934     241 ACKAVNQPLNLRYQTGYDHSYYFIASFIEDHIRHHALA- 278 Anabaena variabilis
WP_010975082     239 LLAERRQAGVVRLQAGYDHSYYFVASFGEDHVRWHAERL 277 Sinorhizobium meliloti
WP_009892737     246 ACRAAGQPLTLRRHAGYDHGYYFISTFIADHIEHHARVL 284 Burkholderia thailandensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap