Conserved Protein Domain Family
formald_GSH

?
TIGR02820: formald_GSH 
S-(hydroxymethyl)glutathione synthase
The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification. [Cellular processes, Detoxification, Central intermediary metabolism, One-carbon metabolism]
Statistics
?
PSSM-Id: 131867
View PSSM: TIGR02820
Aligned: 8 rows
Threshold Bit Score: 354.083
Threshold Setting Gi: 38257349
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8P5F3          5 SIHPAVDGGVVHGSTEgFAGGTLQCLCASNKVTVDVASQSAHNHACGCSKCWKPEGAKFSVVAVAPRDKVTVTAHPEKLK 84  Xanthomonas ca...
Q92WX6          3 KLHPSIDNGFPPASPG-FAGGTLKCKCASNPVTVRIGSQTAHNHACGCTKCWKPEGAIFAQIAVVGRDNVNVTSGAEKLQ 81  Sinorhizobium ...
CAG23432       20 HIHPNVDNGIQPTSDN-FEGGALKCHCRSKIVTVEIKGQSAHNHVCGCSKCWKPNDSLFSQVAVIPRDNLKVTNNESKLQ 98  Photobacterium...
jgi:Psyr2957   19 KLHPALDNGIKSAATD-FAGGTLQCLCPTDKVEVKVDAQTLHNHACGCSKCWKPAGARFAVIAVVNRDKVSVTVNAAKLT 97  Pseudomonas sy...
vfiat:VFA0007   5 KLHPAIDNGFAATDEN-FQGGTLHCQCKENKVAVKLTAQTAHNHACGCSKCWKPEGAIFSQVAVIPRGNVEVIANAEKLV 83  Vibrio fischer...
Q89GX9          4 ALHPSIDNGLKQGSGS-FAGGTLACKCKDHQVKVGIKGDVAHNHACGCTKCWKPQGATFSVVAVVPRQNVTVLENGDKLE 82  Bradyrhizobium...
Q98LU4          4 KLHPRIDNGLPKESAS-FAGGTLVCACTSKPVKVKVKGQIAHNHACGCTKCWKPEGAIFSVVAVAGTGDVTVTENGDKLK 82  Mesorhizobium ...
WP_002719724    7 KIHPSVDDGIVPARDG-FTGGTLKCRCTDRPVEVRINGQSAHNHVCGCTKCWKPDGAIFSMVAVVPRDAVEVVANGDKLK 85  Rhodobacter sp...
Q8P5F3         85 IVDESATIQRHACTGCGVHLYGRIENKDHAFYGLDFIHTELSQQSGWSPPGFAAFVSSIIETGTPPDQMDGVRARLTELG 164 Xanthomonas ca...
Q92WX6         82 VVDPSATIQRYACRDCGTHMYGRIENTKHPFYGLDFVHTELSDETGWSPPEFAAFVSSIIESGVNPESMPEIRARLTELG 161 Sinorhizobium ...
CAG23432       99 VVDESAAIKRFACKDCGVHMYGRIDNTDHPFFGLDFIHTELSAEKGWSAPEFAAFVSSIIETGTNPEDMGAIRKQLQSQG 178 Photobacterium...
jgi:Psyr2957   98 IIDASATIQRHACKECGAHMYGRIENQNHAFHGLDFVHTELSPQTGWAAPGFAAFVSSVIETGTPPAEMDGIRERFNTMG 177 Pseudomonas sy...
vfiat:VFA0007  84 VIDETATIKRHACKECGTHMYGRIDNEGHPFFGLDFVHTELSADKGWSAPQFAAFVSSIIETGTDPKDMDAIRARFVELG 163 Vibrio fischer...
Q89GX9         83 IVDASAVIQRHACKACGTHMYGRIENKNHPFYGLDFIHPELFQEQGSQAPQFAAFVSSVIESGVKPEQMAGIRSRLKEIG 162 Bradyrhizobium...
Q98LU4         83 VVDASALIQRHACTGCGVHMHGPVER-DHAFKGLTFIHPERFVEDGWSPPGFTAFVSSIIESGVDPKRMDGIRAQLRTIG 161 Mesorhizobium ...
WP_002719724   86 VVDPNMAIQRYACTGCGTHMYGRIENKDHPFYGLDFIHTELSSEDGWAAPGFAAFVSSVIESGVSPDRMDGIRARLRELG 165 Rhodobacter sp...
Q8P5F3        165 LTPYDCLSPALMDALSTNVARHK 187 Xanthomonas campestris pv. campestris str. ATCC 33913
Q92WX6        162 LQPYDCLSPPLMDAIATHIAKQT 184 Sinorhizobium meliloti 1021
CAG23432      179 LEPYDCLSPVLMDAIATHIANSK 201 Photobacterium profundum SS9
jgi:Psyr2957  178 LPTYDCLSPALMDALAAHVAKQN 200 Pseudomonas syringae pv. syringae B728a
vfiat:VFA0007 164 LPTYDCLSPALMDAIATHIAAQN 186 Vibrio fischeri ES114
Q89GX9        163 LEPYDCLSPALMDAIATHVAKAK 185 Bradyrhizobium diazoefficiens USDA 110
Q98LU4        162 LEPYDCLNPGLMDYIATWTAKKS 184 Mesorhizobium loti MAFF303099
WP_002719724  166 LEPYDALSPPLMDAIATHVAKRS 188 Rhodobacter sphaeroides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap