Conserved Protein Domain Family
pfaB_fam

?
TIGR02816: pfaB_fam 
PfaB family protein
The protein PfaB is part of four gene locus, similar to polyketide biosynthesis systems, responsible for omega-3 polyunsaturated fatty acid biosynthesis in several high pressure and/or cold-adapted bacteria. The fairly permissive trusted cutoff set for this model allows detection of homologs encoded near homologs to other proteins of the locus: PfaA, PfaC, and/or PfaD. The likely role in every case is either polyunsaturated fatty acid or polyketide biosynthesis.
Statistics
?
PSSM-Id: 131863
View PSSM: TIGR02816
Aligned: 2 rows
Threshold Bit Score: 988.437
Threshold Setting Gi: 15488032
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB81124 210 SHYWFSEFHQNRVAAINF-INGQQATSYVLTQGSGLLAAKSMLNQQRLMFILPGNSQQQITASITQLMQQLERLQvtevN 288 Shewanella sp. SCRC...
AAL01061 162 SHYWFTEPHKARVASLTFnANSDSESSLVLTQATGLQKAQSLLNASRLFFVLSGLNEIELSVQLEQLKQRLADLP----N 237 Photobacterium prof...
AAB81124 289 ELSLECQLELLSIMYDNLVNADKLTTRDSKPAY---QAVIQASSVSAAKQELSALNDALTALFAEQTnatstnkgliQYK 365 Shewanella sp. SCRC...
AAL01061 238 DLTPNDNAALIALMTKNLAQYQTDVSSSATSSIslpTIVLQGASVTAVLQEISAISNALPKVIAEKS----------HYK 307 Photobacterium prof...
AAB81124 366 TPAGSYLTLTPlgsnndNAQAGLAFVYPGVGTVYADMLNELHQYFPALYAKLEREGDLKAMLQAEDIYHLDPkhaAQMSL 445 Shewanella sp. SCRC...
AAL01061 308 TPAGSCFSPAP------NSKGGVTFVYPGVGTVYPGMFRDFHQYFPALFAQLEREGNLKEMLQAEKTYGENP---AEMTL 378 Photobacterium prof...
AAB81124 446 GDLAIAGVGSSYLLTQLLTDEFNIKPNFALGYSMGEASMWASLGVWQNPHALISKTQTDPLFTSAISGKLTAVRQAWQLD 525 Shewanella sp. SCRC...
AAL01061 379 GELAIAGVGSSYLLTQLLCEEFAVKPDFALGYSKGEASMWASLGVWKNPHALIELTQTSPIFTTAISGKLTAVREAWQLT 458 Photobacterium prof...
AAB81124 526 DtAAEIQWNSFVVRSEAAPIEALLKDYPHAYLAIIQGDTCVIAGCEIQCKALLAALGKRGIAANRVTAMHTQPAMQEHQN 605 Shewanella sp. SCRC...
AAL01061 459 D-AEEITWNSFVVRCESATIEALLPEFPRAYLAIIQGDTCVLAGCEATCRALLKKLGKRGIAANRVTAMHTTPALSQHSQ 537 Photobacterium prof...
AAB81124 606 VMDFYLQPLKAELPSEISFISAADLTAKQTVSEQALSSQVVAQSIADTFCQTLDFTALVHHAQHQGAKLFVEIGADRQNC 685 Shewanella sp. SCRC...
AAL01061 538 VTEFYTQPLCDELPMDIKFISAAGLLPQNQNVPVNIDSQSIANSIADTFCTTLDFTALIRTAREQGARLFVEIGADRQTS 617 Photobacterium prof...
AAB81124 686 TLIDKIVKQDGASSVQhqpcCTVPMNAKGSQDITSVIKALGQLISHQVPLSVQPFIDG 743 Shewanella sp. SCRC-2738
AAL01061 618 TLIDKINRTDNVTTES----CTVAANAKGGEDIVTLLKCIAQLITHQIPLSLSPLLQG 671 Photobacterium profundum SS9
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap