3C3J


Conserved Protein Domain Family
agaS_fam

?
TIGR02815: agaS_fam 
Click on image for an interactive view with Cn3D
putative sugar isomerase, AgaS family
Some members of this protein family are found in regions associated with N-acetyl-galactosamine and galactosamine untilization and are suggested to be isomerases.
Statistics
?
PSSM-Id: 131862
View PSSM: TIGR02815
Aligned: 6 rows
Threshold Bit Score: 612.186
Threshold Setting Gi: 7387526
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C3J_A          12 TGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRK--ENLRIILTGAGTSAFIGDIIAPWLASHTGKNFSAVPTT 89  Escherichia c...
CAG22015        16 NAFWTAKEIEQQPSCWRKTHAIIQECLPAISAFMSNALAQ--PNLRIVLTGAGTSAFAGSALAPALSKKTGLRVEAIAST 93  Photobacteriu...
O50523          13 SAVHTVREIAQQPALWREVDRIVGASREALDAFLDPLVAR--GDLRVVLTGAGTSAFAGQVLQPSLARHLGRRVDAVPTT 90  Streptomyces ...
CMCP6:VV2_1023  16 NGIHTAQEISHQPALWRALAEILQQQAPSIEAFLAPLLAR--QDLRIILTGAGTSAFVGDAALPFIQADLRFQVASIPTT 93  Vibrio vulnif...
CAE13129        16 HALHTAREIHQQPELWRQLYQNLQREEALWRPFLQPLLSDpeLQLQIVLCGAGSSAFIGRTLAPWLREQCGLNVVAYSTT 95  Photorhabdus ...
P42907          12 TGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRK--ENLRIILTGAGTSAFIGDIIAPWLASHTGKNFSAVPTT 89  Escherichia c...
3C3J_A          90 DLVTNPXDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLXPAETHDRG 169 Escherichia c...
CAG22015        94 DLVSNPAQFFAEDLPTLLVSFARSGNSPESVAAVELANQCLTNCFHLVLTCNGEGQLYKNAVNDNKSFALLMPEETNDKS 173 Photobacteriu...
O50523          91 DLVADPRGCLAEDLPTLLVSFARSGDSPESVAATALADQVLSEVHHLVITCNEQGRLAREHTRRPRSHVLLMPAASNDRG 170 Streptomyces ...
CMCP6:VV2_1023  94 DLVSNPEQYLDPTRPTLLVSYARSGNSPESVAAVKLVDQLVDEAYHLFLTCNGEGALSRYAQQASNALCVLMPEGSNDKS 173 Vibrio vulnif...
CAE13129        96 DIVPSPLQYLDPTRSTLLISYGRSGNSPESVAAVKLADQLLPRCYHLMLTCNPGGALARYAEGRSHVCSLNMPQGSHDQS 175 Photorhabdus ...
P42907          90 DLVTNPMDYLNPAHPLLLISFGRSGNSPESVAAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLMPAETHDRG 169 Escherichia c...
3C3J_A         170 FAXTSSITTXXASCLAVFAPETINSQTFRDVADRCQAILTS-LGDFSEGVFGyAPWKRIVYLGSGGLQGAARESALKVLE 248 Escherichia c...
CAG22015       174 FAMTSSFSSMMLAAFSVVTSGNDYTKEIERFCKCSEGLVKE-INNNISSIAG-DTIQRVIYLGSGGLQGLAQESALKLLE 251 Photobacteriu...
O50523         171 FAMTSSFTCMTLAALLALG-KDARDGVAERLARAAESIIEDgAADRTAGALVdRAPERIVFLGSGPLKGLAEESALKVLE 249 Streptomyces ...
CMCP6:VV2_1023 174 FAMTSSFSCMLMSTLALLG----EFSAEAMFATAALCESKLtQWPEAVKQLAaLPYERLIVLGSGGFAGLAREASLKSLE 249 Vibrio vulnif...
CAE13129       176 FAMTSSFSCMTLATVLLLGPLTLEQCDEPLMAMIALCEREReQWQTQIKRLAcSGFNRMMCLGSSCFTGIAEEGALKMLE 255 Photorhabdus ...
P42907         170 FAMTSSITTMMASCLAVFAPETINSQTFRDVADRCQAILTS-LGDFSEGVFGyAPWKRIVYLGSGGLQGAARESALKVLE 248 Escherichia c...
3C3J_A         249 LTAGKLAAFYDSPTGFRHGPKSLVDDETLVVVFVSSHPYTRQYDLDLLAELRRDNQAXRVIAIAAESSDIVAAGPHIILP 328 Escherichia c...
CAG22015       252 LTAGKVVACFDSPLGFRHGPKSIVDNETMIVVYISNDPYTRQYDLDLLSELRRDNTAKKVIAITAQKDELVANGDYYLVP 331 Photobacteriu...
O50523         250 LTGGTLMAVAESSLGFRHGPKAVLNERSVAVVYVSNDPYTRRYDHDIVAELRGNLPVGSVVAVSAESGAGTEGADAWPLP 329 Streptomyces ...
CMCP6:VV2_1023 250 LSAGKVMTAFDSSLGFRHGPKFTINDKALVVQLLSSDDYTRQYDLDLLREIRRDNQALRHVALTEKP---LSEEHVFELG 326 Vibrio vulnif...
CAE13129       256 LTAGHVTTRYDSSMGVRHGPKFMIERDTLVVMMLSADQYRRRYDLDLWHELNHDGLACQIVALSG------TQGKGFTVI 329 Photorhabdus ...
P42907         249 LTAGKLAAFYDSPTGFRHGPKSLVDDETLVVVFVSSHPYTRQYDLDLLAELRRDNQAMRVIAIAAESSDIVAAGPHIILP 328 Escherichia c...
3C3J_A         329 PSRHFIDVEQAFCFLXYAQTFALXQSLHXGNTPDTPSASGTVNRVVQGVIIHPW 382 Escherichia coli K-12
CAG22015       332 DMDSATDVELLFPYMIFAQTYAFHRAIALGNTPDNPCPTGEVNRVVQGVTIHKF 385 Photobacterium profundum SS9
O50523         330 GLGDVEDAALALPAVVYAQLIALRASQARGLRPDNPFPSGEVNRVVQGVTLHSL 383 Streptomyces coelicolor A3(2)
CMCP6:VV2_1023 327 QL-GLGDRWLCFPYILFCQMLAFEKSLQLGFGPDNPCPTGEVNRVVQGVTIYPF 379 Vibrio vulnificus CMCP6
CAE13129       330 NS-EQDDIWLLFPYLIFLQMLAFETSLALGITPDNPCPTGEVNRVVKGVEIYPY 382 Photorhabdus luminescens subsp. laumond...
P42907         329 PSRHFIDVEQAFCFLMYAQTFALMQSLHMGNTPDTPSASGTVNRVVQGVIIHPW 382 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap