
Conserved Protein Domain Family

TIGR02815: agaS_fam 
Click on image for an interactive view with Cn3D
putative sugar isomerase, AgaS family
Some members of this protein family are found in regions associated with N-acetyl-galactosamine and galactosamine untilization and are suggested to be isomerases.
PSSM-Id: 131862
Aligned: 6 rows
Threshold Bit Score: 612.186
Threshold Setting Gi: 7387526
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
CAE13129       330 NS-EQDDIWLLFPYLIFLQMLAFETSLALGITPDNPCPTGEVNRVVKGVEIYPY 382 Photorhabdus luminescens subsp. laumond...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap