1HW1


Conserved Protein Domain Family
fadR_gamma

?
TIGR02812: fadR_gamma 
Click on image for an interactive view with Cn3D
fatty acid metabolism transcriptional regulator FadR
Members of this family are FadR, a transcriptional regulator of fatty acid metabolism, including both biosynthesis and beta-oxidation. It is found exclusively in a subset of Gammaproteobacteria, with strictly one copy per genome. It has an N-terminal DNA-binding domain and a less well conserved C-terminal long chain acyl-CoA-binding domain. FadR from this family heterologously expressed in Escherichia coli show differences in regulatory response and fatty acid binding profiles. The family is nevertheless designated equivalog, as all member proteins have at least nominally the same function. [Fatty acid and phospholipid metabolism, Biosynthesis, Fatty acid and phospholipid metabolism, Degradation, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 163028
View PSSM: TIGR02812
Aligned: 10 rows
Threshold Bit Score: 415.605
Threshold Setting Gi: 46914207
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HW1_A          2 VIKAQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETSGLN 81  Escherichia coli
P44705          7 ILKAQSPAALAEEYIVKSIWQDVFPAGSNLPSERDLADKIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNIWDAAGPN 86  Haemophilus in...
AAU37038       13 VLKARSPAALAEEYIVKSIWSNFYPPGTDLPAERELAEKIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNDVWQTSGLN 92  Mannheimia suc...
P0A8V9          2 VIKAQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETSGLN 81  Shigella flexneri
tigr:CPS_3488   2 VIKAKSPAGFAEQYIVESIWNGGFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNDFWETSSLN 81  Colwellia psyc...
Q8ED80          2 IINAKGPASFAEKYIVRSIWENKFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLKIQHGKPTRVNNFWETSGLN 81  Shewanella one...
Q9KQU8          2 VIKAKSPAGFAEKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNQFMETSGLH 81  Vibrio cholera...
CAG20987        2 VIKADSPATFAEKYIIESIWNGHFPQGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTRVNNYMETSGLS 81  Photobacterium...
WP_011327531    3 IFKAKSPAGFAEEYIVESIWNGDFPPGSILPAERELSELIGVTRTTLREVLQRLARDGWLTIKHGKPTKVNNFWETSGLN 82  Pseudoalteromo...
WP_005568029    7 LLKAQSPAALAEEYIVKSIWNNHFPPGSDLPAERELADKIGVTRTTLREVLQRLARDGWLNIQHGKPTKVNDIWETSGLN 86  Aggregatibacte...
1HW1_A         82 ILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPD----------KAQEVLATAN------------------- 132 Escherichia coli
P44705         87 IIETLIALDMQSAPLIIDNMLSLRSKMSESYIYEAVKNSPQ----------KSTALFAELE------------------- 137 Haemophilus in...
AAU37038       93 ILDVLVRLDSTMSPTLIANMLSARTNIAIIYIPRAFKVSYE----------KALASFDGLEn------------------ 144 Mannheimia suc...
P0A8V9         82 ILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPD----------KAQEVLATAN------------------- 132 Shigella flexneri
tigr:CPS_3488  82 ILETLVQLDQDGIPDLVDNLLSARTNISAIYIRAALKNNPK----------KAIESLEAYI------------------- 132 Colwellia psyc...
Q8ED80         82 ILETIADLNPEGFPVLVDQLLSARTNVSAIYFRGALRNNPD----------TAMEVLAQIH------------------- 132 Shewanella one...
Q9KQU8         82 ILDTLMTLDAENATSIVEDLLAARTNISPIFMRYAFKLNKEsaeriminviESCEALVNAPswdafiaas----pyaeki 157 Vibrio cholera...
CAG20987       82 ILDTLITLDGQDVQSVLEDLLAARTDISSVFMRYAVKGNGKesseliehviQSCEELLNANsfaefvensddklplmqqv 161 Photobacterium...
WP_011327531   83 ILETLARLDEDKMPELTDQLLSARTNISAIYTRAAIKLNPE----------RVIEILSQSD------------------- 133 Pseudoalteromo...
WP_005568029   87 ILETMIQLDGSRLPSLTANMRSARTDISMIYIPKAFKRAPE----------RSLHILHPMD------------------- 137 Aggregatibacte...
1HW1_A        133 --EVADH-------------ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLS 197 Escherichia coli
P44705        138 --QLQNT-------------AQDYTEFDYQLFRQFTVVANKPFYRLIFNSLKGVYQRIGLLFFKEKKHRELTKQFYLEMQ 202 Haemophilus in...
AAU37038      145 ---LPET-------------AESYTAFDYEILHKLAFISLNPIYGMVLNSLKGLYTRVGSYYFAIPEARALAKKFYIELR 208 Mannheimia suc...
P0A8V9        133 --EVADH-------------ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLS 197 Shigella flexneri
tigr:CPS_3488 133 --DVEDS-------------AEAFSQFDYQLNKDLVIASGNSIYLLILNGLSGLYSRIGNLYFANPKGREISINYYKKLI 197 Colwellia psyc...
Q8ED80        133 --QLEDT-------------AESFAEYDYLLHHTLAFSSGNPLYVLILNGFKGLYSRVGRYYFSSSEARQLALNFYKELE 197 Shewanella one...
Q9KQU8        158 qqHVKEDsekdelkrqeiliAKTFNFYDYMLFQRLAFHSGNQIYGLIFNGLKKLYDRVGSYYFSNPQARELAMEFYRQLL 237 Vibrio cholera...
CAG20987      162 kkIVDKYgktdpelceaicrARAFNYYDYRLFQGLAGKSGNKLYVLTINGLRKIYTRVGGYYFMSPEACQLALDFYREMQ 241 Photobacterium...
WP_011327531  134 --ELEDS-------------AQAFADYDYKVHHELAVAGNNRIYVLILNGFKGFYSKIGCHYFSDPGTRELARQFYKDLT 198 Pseudoalteromo...
WP_005568029  138 --NLEDT-------------AEDYTKFDYDVFRNLAFASDNPVYGLILNSFKSLYTRIGLFYFQSAEARELARRFYFNLR 202 Aggregatibacte...
1HW1_A        198 ALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDLAI 236 Escherichia coli
P44705        203 QICLEGNADAVVDCIRKHNLRSSTYWKAILERLPQNLSD 241 Haemophilus influenzae Rd KW20
AAU37038      209 ELGKAHRLDEIPSLFRQYGRESSLIFEAAQDGLAQYLIE 247 Mannheimia succiniciproducens MBEL55E
P0A8V9        198 ALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDLAI 236 Shigella flexneri
tigr:CPS_3488 198 ELAKAEKFDEAIFAVRQNGIDSGLLWSDLKDEVLQELSE 236 Colwellia psychrerythraea 34H
Q8ED80        198 LLAKAKNYLDVPALMRTYGINSGKMWLQLRDDMPSSIAQ 236 Shewanella oneidensis MR-1
Q9KQU8        238 AVCQSGEREHLPQVIRQYGIASGHIWNQMKMTLPSNFTE 276 Vibrio cholerae O1 biovar El Tor str. N16961
CAG20987      242 SYCDNNQPDHVADRLKKYGRESGAIWYSNRIEIAHYLYE 280 Photobacterium profundum SS9
WP_011327531  199 KLAENREHDGAIMMMRKYGHQTGEIWQQIRGDMPSDIMD 237 Pseudoalteromonas haloplanktis
WP_005568029  203 DICQRQSIEEVAPCILQYGKESSAQWTKMQEFLPKDFSE 241 Aggregatibacter actinomycetemcomitans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap